KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_4444
Entry
G2583_4444        CDS       T01190                                 
Symbol
espG
Name
(GenBank) hypothetical protein
  KO
K12785  LEE-encoded effector EspG
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:eok00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    G2583_4444 (espG)
SSDB
Motif
Pfam: EspG ASXH
Other DBs
NCBI-ProteinID: ADD58911
UniProt: D3QW50
LinkDB
Position
4508913..4510109
AA seq 398 aa
MILVAKLFITNQIGESLMINGLNNDSASLVLDAAMKVNSGFKKSWDEMSCAEKLFKVLSF
GLWNPTYSRSERQSFQELLTVLEPVYPLPNELGRVSARFSDGSSLRISVTNSELVEAEIR
TANNEKITVLLESNEQNRLLQSLPIDRHMPYIQVHRALSEMDLTDTTSMRNLLGFTSKLS
TTLIPHNAQTDPLSGPTPFSSIFMDTCRGLGNAKLSLNGVDIPANAQKLLRDALGLKDTH
SSPTRNVIDHGISRHDAEQIARESSGSDKQKAEVVEFLCHPEAATAICSAFYQSFNVPAL
TLTHERISKASEYNAERSLDTPNACINISISQSSDGNIYVTSHTGVLIMAPEDRPNEMGM
LTNRTSYEVPQGVKCIIDEMVSALQPRYAASETYLQNT
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgatacttgttgccaaattgttcattacaaaccagataggagaatctctcatgataaat
ggacttaataatgactccgcatctttagttttagatgctgcaatgaaagttaattctggg
tttaaaaaaagctgggatgagatgtcatgcgctgaaaagttatttaaagtacttagtttt
ggtttatggaatccaacgtacagtcgtagtgaaagacaatcatttcaagagttgttaacc
gttttagagcctgtatatccacttcccaatgaattaggcagagtatctgctcgtttttca
gatggttcatccttaagaatttccgtcactaacagcgaacttgttgaagccgagattcgc
acagcaaataatgaaaagattactgtgctcctggagtcaaacgaacaaaataggttatta
caatctttacccatcgatcgccacatgccatacattcaggttcatcgtgccttatctgag
atggacctgactgatactacctcaatgcgcaatctacttggttttacgtcaaaactatca
acaaccttgattcctcataatgctcaaacagatccgctttccgggcctacaccattcagc
tctatctttatggatacatgtcgaggactcggcaatgcaaagctttcactcaatggtgtt
gatatacctgcaaatgcacaaaaattgcttcgcgatgcactaggacttaaagacacacat
tcatcaccaacccggaatgttatagatcatggtatttctcgccatgatgcagagcaaata
gcaagagaaagcagcggcagtgataaacagaaagctgaagttgtggaatttttatgccat
ccagaagcagcaacggccatatgctcggctttctatcaatctttcaatgtgccagcctta
acgttgacacatgaaaggatctctaaagccagtgaatacaatgcggaaagatcattagat
acacctaacgcttgcattaacatcagtatctctcaatcatcagatggaaacatttatgtt
accagccatactggggttctgataatggcgccagaagaccgccccaacgagatgggcatg
ttgacgaacaggacttcttatgaagtgccgcaaggtgtgaaatgtataatcgatgaaatg
gtaagtgcgctacaaccaaggtatgccgcatctgaaacgtacttacaaaacacttaa

DBGET integrated database retrieval system