KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_pO550114
Entry
G2583_pO550114    CDS       T01190                                 
Name
(GenBank) NleA6-1 protein
  KO
K16041  non-LEE-encoded effector NleA
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:eok00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    G2583_pO550114
SSDB
Motif
Pfam: DUF6132
Other DBs
NCBI-ProteinID: ADD59748
UniProt: D3QYS4
LinkDB
Position
pO55:49589..50914
AA seq 441 aa
MNIQPIVQSGITTQNNQHNQAEQAPPAQIPQSELPNGCEAGFVVHIPDDIQQHAPECGER
TALLSLIQDEGLLSGLDKYLAPHLEEGSAGKKALDMFGLFNVTQMALEIPSTVRGISGKY
GVQMNIVKPDIHPTSGNYFLQIFPLHDEIGLNFKDLPGPLKNALSNINISTTAVSAITSA
ATSATTSTVTTEPKDPIPWFGLTAQVVRNHGVELPIVKTENGWKLVGETPLTPDGPKANY
TEEWVIRPGEADFKYGTSPLQATLGLEFGAHFKWDLDNPNTKYAVLTNAAANALGAAGGF
AVSKIPGVDPMLAPHIGAMVGQAAGHAIQCNTPGLKPDTILWWAGTTLGLADLNKAETGE
ARFTDYPRIWWHAREGAIFPNKEDIARATGADIRAMEEGVPVGQSHPRPEDVVINIESND
LPHHNPLNHVDIVDIIQETRV
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgaacattcaaccgatcgtacaatccggaatcaccacacaaaacaatcaacataatcag
gcagaacaagcgccccctgcacaaataccgcaatccgaattacctaatggatgcgaagcg
ggatttgttgttcatattccagatgatatacagcaacatgctccggaatgtggtgaaaga
acggcactattgagtttgatacaagatgaaggtctgctctctgggctggataaatatctt
gcacctcatcttgaagaaggttctgcagggaaaaaagcgttggatatgtttggtttattc
aatgtcactcagatggcattagaaatacccagcaccgttcggggtatctctggtaaatat
ggtgttcagatgaacattgtaaaaccagatattcatcctacatcaggtaattatttttta
cagattttccctttgcatgatgaaataggtcttaattttaaagaccttcctggtccatta
aaaaatgcattaagcaatatcaatatatctaccactgcagtgtcggctattacatcggct
gcaacatcagccactacttcgacggtaaccaccgagccaaaagacccaataccatggttt
ggattaacagctcaagtagttcgtaaccatggtgtggaacttcctatagtcaaaactgaa
aatggatggaagcttgttggagaaacgcctcttactcctgatgggccaaaagcaaattac
acggaggagtgggttatcagaccgggagaagcagattttaaatatggtacatctccacta
caggcaactctagggctggagtttggcgcacatttcaaatgggatttagataaccctaat
actaaatatgccgttcttaccaatgctgccgcaaatgcgcttggcgccgcaggagggttt
gcagtatccaaaatccccggagtagacccaatgttagcccctcatatcggcgcaatggtt
gggcaagcagcagggcatgccatacagtgtaatacccccggattaaagccagacactatt
ttatggtgggctggtacgactctggggctagcagatttaaacaaagccgagacaggtgaa
gccagattcactgactatcctcgtatatggtggcatgcaagagaaggtgccatttttccc
aataaagaagatattgcccgtgcaacaggggctgatatacgagcgatggaagaaggtgta
cctgttggacaaagccatccacgtccagaggatgtagtcatcaatatcgaaagcaatgac
ttaccacatcataatccattaaatcatgttgatatcgttgatataatccaagaaacaaga
gtctaa

DBGET integrated database retrieval system