Equus przewalskii (Przewalski's horse): 103543692 Help Entry 103543692         CDS       T04644                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz01523   Antifolate resistance epz04010   MAPK signaling pathway epz04014   Ras signaling pathway epz04024   cAMP signaling pathway epz04062   Chemokine signaling pathway epz04064   NF-kappa B signaling pathway epz04066   HIF-1 signaling pathway epz04071   Sphingolipid signaling pathway epz04137   Mitophagy - animal epz04151   PI3K-Akt signaling pathway epz04210   Apoptosis epz04211   Longevity regulating pathway epz04218   Cellular senescence epz04380   Osteoclast differentiation epz04613   Neutrophil extracellular trap formation epz04620   Toll-like receptor signaling pathway epz04621   NOD-like receptor signaling pathway epz04622   RIG-I-like receptor signaling pathway epz04623   Cytosolic DNA-sensing pathway epz04625   C-type lectin receptor signaling pathway epz04657   IL-17 signaling pathway epz04658   Th1 and Th2 cell differentiation epz04659   Th17 cell differentiation epz04660   T cell receptor signaling pathway epz04662   B cell receptor signaling pathway epz04668   TNF signaling pathway epz04722   Neurotrophin signaling pathway epz04917   Prolactin signaling pathway epz04920   Adipocytokine signaling pathway epz04926   Relaxin signaling pathway epz04931   Insulin resistance epz04932   Non-alcoholic fatty liver disease epz04933   AGE-RAGE signaling pathway in diabetic complications epz04936   Alcoholic liver disease epz05010   Alzheimer disease epz05022   Pathways of neurodegeneration - multiple diseases epz05030   Cocaine addiction epz05132   Salmonella infection epz05133   Pertussis epz05134   Legionellosis epz05135   Yersinia infection epz05140   Leishmaniasis epz05142   Chagas disease epz05145   Toxoplasmosis epz05146   Amoebiasis epz05152   Tuberculosis epz05160   Hepatitis C epz05161   Hepatitis B epz05162   Measles epz05163   Human cytomegalovirus infection epz05164   Influenza A epz05165   Human papillomavirus infection epz05166   Human T-cell leukemia virus 1 infection epz05167   Kaposi sarcoma-associated herpesvirus infection epz05168   Herpes simplex virus 1 infection epz05169   Epstein-Barr virus infection epz05170   Human immunodeficiency virus 1 infection epz05171   Coronavirus disease - COVID-19 epz05200   Pathways in cancer epz05202   Transcriptional misregulation in cancer epz05203   Viral carcinogenesis epz05207   Chemical carcinogenesis - receptor activation epz05208   Chemical carcinogenesis - reactive oxygen species epz05212   Pancreatic cancer epz05215   Prostate cancer epz05220   Chronic myeloid leukemia epz05221   Acute myeloid leukemia epz05222   Small cell lung cancer epz05235   PD-L1 expression and PD-1 checkpoint pathway in cancer epz05321   Inflammatory bowel disease epz05415   Diabetic cardiomyopathy epz05417   Lipid and atherosclerosis epz05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:epz00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103543692 (RELA)    04014 Ras signaling pathway     103543692 (RELA)    04064 NF-kappa B signaling pathway     103543692 (RELA)    04668 TNF signaling pathway     103543692 (RELA)    04066 HIF-1 signaling pathway     103543692 (RELA)    04071 Sphingolipid signaling pathway     103543692 (RELA)    04024 cAMP signaling pathway     103543692 (RELA)    04151 PI3K-Akt signaling pathway     103543692 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     103543692 (RELA)   09143 Cell growth and death    04210 Apoptosis     103543692 (RELA)    04218 Cellular senescence     103543692 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103543692 (RELA)    04620 Toll-like receptor signaling pathway     103543692 (RELA)    04621 NOD-like receptor signaling pathway     103543692 (RELA)    04622 RIG-I-like receptor signaling pathway     103543692 (RELA)    04623 Cytosolic DNA-sensing pathway     103543692 (RELA)    04625 C-type lectin receptor signaling pathway     103543692 (RELA)    04660 T cell receptor signaling pathway     103543692 (RELA)    04658 Th1 and Th2 cell differentiation     103543692 (RELA)    04659 Th17 cell differentiation     103543692 (RELA)    04657 IL-17 signaling pathway     103543692 (RELA)    04662 B cell receptor signaling pathway     103543692 (RELA)    04062 Chemokine signaling pathway     103543692 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     103543692 (RELA)    04917 Prolactin signaling pathway     103543692 (RELA)    04926 Relaxin signaling pathway     103543692 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     103543692 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     103543692 (RELA)   09149 Aging    04211 Longevity regulating pathway     103543692 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103543692 (RELA)    05202 Transcriptional misregulation in cancer     103543692 (RELA)    05207 Chemical carcinogenesis - receptor activation     103543692 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     103543692 (RELA)    05203 Viral carcinogenesis     103543692 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103543692 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     103543692 (RELA)    05221 Acute myeloid leukemia     103543692 (RELA)    05220 Chronic myeloid leukemia     103543692 (RELA)    05215 Prostate cancer     103543692 (RELA)    05222 Small cell lung cancer     103543692 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103543692 (RELA)    05170 Human immunodeficiency virus 1 infection     103543692 (RELA)    05161 Hepatitis B     103543692 (RELA)    05160 Hepatitis C     103543692 (RELA)    05171 Coronavirus disease - COVID-19     103543692 (RELA)    05164 Influenza A     103543692 (RELA)    05162 Measles     103543692 (RELA)    05168 Herpes simplex virus 1 infection     103543692 (RELA)    05163 Human cytomegalovirus infection     103543692 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     103543692 (RELA)    05169 Epstein-Barr virus infection     103543692 (RELA)    05165 Human papillomavirus infection     103543692 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     103543692 (RELA)    05135 Yersinia infection     103543692 (RELA)    05133 Pertussis     103543692 (RELA)    05134 Legionellosis     103543692 (RELA)    05152 Tuberculosis     103543692 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     103543692 (RELA)    05145 Toxoplasmosis     103543692 (RELA)    05140 Leishmaniasis     103543692 (RELA)    05142 Chagas disease     103543692 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     103543692 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     103543692 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     103543692 (RELA)   09165 Substance dependence    05030 Cocaine addiction     103543692 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103543692 (RELA)    05418 Fluid shear stress and atherosclerosis     103543692 (RELA)    05415 Diabetic cardiomyopathy     103543692 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     103543692 (RELA)    04932 Non-alcoholic fatty liver disease     103543692 (RELA)    04931 Insulin resistance     103543692 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     103543692 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     103543692 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:epz03000]     103543692 (RELA) Transcription factors [BR:epz03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     103543692 (RELA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  103543692 NCBI-ProteinID:  XP_070421598 LinkDB All DBs Position 11:complement(26996623..27006633) Genome browser AA seq 551 aa AA seqDB search MEDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLSPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPARSSASVPKPAPQPYPFTPSLSTINF EEFSPMVFPSGTIPSQTSALAPAPAPVLAQAPAPAPAMASALAQAPAPVPVLAAGLAQAV APPAPRTTQAGEGTLTEALLQLQFDADEDLGALLGNNTDPAVFTDLASVDNSEFQQLLNQ GVSMAPHTAEPMLMEYPEAITRLMSGSQRPPDPAPAPLGASGLPNGLLSGDEDFSSISDM DFSALLSQISS NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt atggaagacctgttccccctcatcttcccttcggagccagcccaggcttctggcccctat gtggagatcattgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggg cgctcagcgggcagcatcccgggcgagaggagcacggataccaccaagacccaccccacc atcaagatcaatggctacacggggccagggacagttcgcatctccctggtcaccaaggac cctcctcaccggcctcacccccacgagcttgtggggaaagactgccgggacggcttctat gaggctgagctctgccctgaccgctgcatccacagcttccagaacctggggatccagtgt gtaaagaagcgagacctggagcaggccatcagtcagcgcatccagaccaacaacaacccc ttccaagttcccatagaagagcagcgtggggactacgacctgaatgcggtgcggctatgc ttccaggtgacagtgcgggacccggcaggcaggcccctccgcctgtcgcctgtcctttct catcccatctttgacaaccgcgcccccaacactgctgagctcaagatctgccgagtgaac cggaactccgggagctgcctcgggggcgatgagatcttcctgctttgtgacaaggtgcag aaagaggacatcgaggtgtatttcacgggaccaggctgggaggcccgaggctccttttca caagccgatgttcaccgacaagtggccattgtgttccggacacctccctacgcggacccc agcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcggatcgggagctc agcgagcccatggagttccagtatttgccagacacagatgatcgtcaccgaattgaggag aaacgcaaaaggacatatgagaccttcaagagcatcatgaaaaagagtcctttcaatgga cccaccgacccccggcccccgccccggcgcattgctgtgcctgcccgcagctcagcctcc gtccccaagccagctccccagccctatccctttacgccatccctcagcaccatcaacttt gaggaattttcccccatggtctttccttctgggacgatcccaagccagacctcggccttg gcaccagcccctgccccagtcctggcgcaggccccagcccctgccccagccatggcatca gctctggcccaggccccagctcccgtccctgtcctagccgcaggccttgctcaggccgtg gccccgcctgcccccaggaccacccaagctggggaagggacactgacggaggccctgctg cagctgcagtttgatgctgatgaagacctgggggccctgctcggcaataacactgacccg gccgtgttcacggacctggcatctgtcgacaactctgagtttcagcagctgctgaaccag ggtgtctctatggccccccacacagctgagcccatgctgatggagtaccctgaggctata actcgcctgatgtcagggtcccagcggccccctgacccagctcccgctcccctgggggcc tctgggctccccaacggtctcctctcaggggacgaagacttctcctccatttcggacatg gacttctcagcccttctgagtcagatcagctcctag

DBGET integrated database retrieval system