Equus przewalskii (Przewalski's horse): 103552182 Help Entry 103552182         CDS       T04644                                  Symbol NPPA Name (RefSeq) natriuretic peptides A   KO K12334   natriuretic peptide A Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz04022   cGMP-PKG signaling pathway epz04024   cAMP signaling pathway epz04066   HIF-1 signaling pathway epz04081   Hormone signaling epz04270   Vascular smooth muscle contraction epz04714   Thermogenesis epz04921   Oxytocin signaling pathway epz04923   Regulation of lipolysis in adipocytes epz04924   Renin secretion epz04925   Aldosterone synthesis and secretion epz05143   African trypanosomiasis Brite KEGG Orthology (KO) [BR:epz00001]  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     103552182 (NPPA)    04024 cAMP signaling pathway     103552182 (NPPA)    04022 cGMP-PKG signaling pathway     103552182 (NPPA)   09133 Signaling molecules and interaction    04081 Hormone signaling     103552182 (NPPA)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     103552182 (NPPA)    04921 Oxytocin signaling pathway     103552182 (NPPA)    04924 Renin secretion     103552182 (NPPA)    04925 Aldosterone synthesis and secretion     103552182 (NPPA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     103552182 (NPPA)   09159 Environmental adaptation    04714 Thermogenesis     103552182 (NPPA)  09160 Human Diseases   09174 Infectious disease: parasitic    05143 African trypanosomiasis     103552182 (NPPA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:epz04052]     103552182 (NPPA) Cytokines and neuropeptides [BR:epz04052]  Neuropeptides   Unclassified    103552182 (NPPA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  103552182 NCBI-ProteinID:  XP_070466895 LinkDB All DBs Position 2:39761726..39765003 Genome browser AA seq 153 aa AA seqDB search MGSFSTIMASFLLFLAFQLQGQTRANPVYGSVSNGDLMDFKNLLDRLEDKMPLEDEVMPP QVLSDQSEEERAALSPLPEVPPWTGEVNPAQRDGGALGRGSWDSSDRSALLKSKLRALLA APRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgggctccttctccaccatcatggcgagcttcctcctctttctggcatttcagctccaa gggcaaaccagagctaaccccgtgtatggctctgtgtccaacggagacctgatggatttc aagaatttgctggatcgtttggaggacaagatgcctttagaagatgaggtgatgccccca caagtactaagtgatcagagtgaggaagagagggcagctctcagccccctccctgaggtg cctccctggaccggggaggtcaatccagcccagagagatgggggtgcccttgggcggggc tcctgggactcctccgacagatctgccctcctgaaaagcaagctgagggcactgctcgct gctcctcggagcctacggaggtccagctgcttcgggggcaggatggacaggattggagcc cagagtggactgggctgcaacagcttccggtaccgaagataa

DBGET integrated database retrieval system