Equus przewalskii (Przewalski's horse): 103558687 Help Entry 103558687         CDS       T04644                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz04010   MAPK signaling pathway epz04014   Ras signaling pathway epz04015   Rap1 signaling pathway epz04024   cAMP signaling pathway epz04062   Chemokine signaling pathway epz04510   Focal adhesion epz04520   Adherens junction epz04611   Platelet activation epz04670   Leukocyte transendothelial migration epz04720   Long-term potentiation epz04722   Neurotrophin signaling pathway epz04934   Cushing syndrome epz04972   Pancreatic secretion epz05211   Renal cell carcinoma epz05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:epz00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103558687 (RAP1B)    04014 Ras signaling pathway     103558687 (RAP1B)    04015 Rap1 signaling pathway     103558687 (RAP1B)    04024 cAMP signaling pathway     103558687 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     103558687 (RAP1B)    04520 Adherens junction     103558687 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     103558687 (RAP1B)    04670 Leukocyte transendothelial migration     103558687 (RAP1B)    04062 Chemokine signaling pathway     103558687 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     103558687 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     103558687 (RAP1B)    04722 Neurotrophin signaling pathway     103558687 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     103558687 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103558687 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     103558687 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:epz04147]     103558687 (RAP1B)    04031 GTP-binding proteins [BR:epz04031]     103558687 (RAP1B) Exosome [BR:epz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103558687 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    103558687 (RAP1B)   Exosomal proteins of colorectal cancer cells    103558687 (RAP1B) GTP-binding proteins [BR:epz04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     103558687 (RAP1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  103558687 NCBI-ProteinID:  XP_070478122 LinkDB All DBs Position 5:84597819..84638548 Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CRLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctggtcgttctcggctcgggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacaatagaagattcttat agaaagcaagttgaagtagatgcacagcagtgtatgcttgaaatcttggatactgcggga acggaacaatttacagcaatgagggatttgtacatgaaaaatggacaaggctttgcgtta gtttattccatcacagcacagtccacatttaatgatttgcaagatctgagagagcagatt cttcgagttaaagacactgacgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacagtggaacaac tgtgcattcttagaatcctctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgaggcaaattaacagaaaaactcccgtgcctgggaaggctcgcaaaaagtcgtcg tgtcggctgctttaa

DBGET integrated database retrieval system