Equus przewalskii (Przewalski's horse): 103562469 Help Entry 103562469         CDS       T04644                                  Symbol TNF Name (RefSeq) tumor necrosis factor isoform X1   KO K03156   tumor necrosis factor superfamily, member 2 Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz01523   Antifolate resistance epz04010   MAPK signaling pathway epz04060   Cytokine-cytokine receptor interaction epz04061   Viral protein interaction with cytokine and cytokine receptor epz04064   NF-kappa B signaling pathway epz04071   Sphingolipid signaling pathway epz04150   mTOR signaling pathway epz04210   Apoptosis epz04217   Necroptosis epz04350   TGF-beta signaling pathway epz04380   Osteoclast differentiation epz04612   Antigen processing and presentation epz04620   Toll-like receptor signaling pathway epz04621   NOD-like receptor signaling pathway epz04622   RIG-I-like receptor signaling pathway epz04625   C-type lectin receptor signaling pathway epz04640   Hematopoietic cell lineage epz04650   Natural killer cell mediated cytotoxicity epz04657   IL-17 signaling pathway epz04660   T cell receptor signaling pathway epz04664   Fc epsilon RI signaling pathway epz04668   TNF signaling pathway epz04920   Adipocytokine signaling pathway epz04930   Type II diabetes mellitus epz04931   Insulin resistance epz04932   Non-alcoholic fatty liver disease epz04933   AGE-RAGE signaling pathway in diabetic complications epz04936   Alcoholic liver disease epz04940   Type I diabetes mellitus epz05010   Alzheimer disease epz05014   Amyotrophic lateral sclerosis epz05020   Prion disease epz05022   Pathways of neurodegeneration - multiple diseases epz05132   Salmonella infection epz05133   Pertussis epz05134   Legionellosis epz05135   Yersinia infection epz05140   Leishmaniasis epz05142   Chagas disease epz05143   African trypanosomiasis epz05144   Malaria epz05145   Toxoplasmosis epz05146   Amoebiasis epz05152   Tuberculosis epz05160   Hepatitis C epz05161   Hepatitis B epz05163   Human cytomegalovirus infection epz05164   Influenza A epz05165   Human papillomavirus infection epz05166   Human T-cell leukemia virus 1 infection epz05168   Herpes simplex virus 1 infection epz05169   Epstein-Barr virus infection epz05170   Human immunodeficiency virus 1 infection epz05171   Coronavirus disease - COVID-19 epz05205   Proteoglycans in cancer epz05310   Asthma epz05321   Inflammatory bowel disease epz05322   Systemic lupus erythematosus epz05323   Rheumatoid arthritis epz05330   Allograft rejection epz05332   Graft-versus-host disease epz05410   Hypertrophic cardiomyopathy epz05414   Dilated cardiomyopathy epz05417   Lipid and atherosclerosis epz05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:epz00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103562469 (TNF)    04350 TGF-beta signaling pathway     103562469 (TNF)    04064 NF-kappa B signaling pathway     103562469 (TNF)    04668 TNF signaling pathway     103562469 (TNF)    04071 Sphingolipid signaling pathway     103562469 (TNF)    04150 mTOR signaling pathway     103562469 (TNF)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103562469 (TNF)    04061 Viral protein interaction with cytokine and cytokine receptor     103562469 (TNF)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     103562469 (TNF)    04217 Necroptosis     103562469 (TNF)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     103562469 (TNF)    04620 Toll-like receptor signaling pathway     103562469 (TNF)    04621 NOD-like receptor signaling pathway     103562469 (TNF)    04622 RIG-I-like receptor signaling pathway     103562469 (TNF)    04625 C-type lectin receptor signaling pathway     103562469 (TNF)    04650 Natural killer cell mediated cytotoxicity     103562469 (TNF)    04612 Antigen processing and presentation     103562469 (TNF)    04660 T cell receptor signaling pathway     103562469 (TNF)    04657 IL-17 signaling pathway     103562469 (TNF)    04664 Fc epsilon RI signaling pathway     103562469 (TNF)   09152 Endocrine system    04920 Adipocytokine signaling pathway     103562469 (TNF)   09158 Development and regeneration    04380 Osteoclast differentiation     103562469 (TNF)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     103562469 (TNF)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103562469 (TNF)    05170 Human immunodeficiency virus 1 infection     103562469 (TNF)    05161 Hepatitis B     103562469 (TNF)    05160 Hepatitis C     103562469 (TNF)    05171 Coronavirus disease - COVID-19     103562469 (TNF)    05164 Influenza A     103562469 (TNF)    05168 Herpes simplex virus 1 infection     103562469 (TNF)    05163 Human cytomegalovirus infection     103562469 (TNF)    05169 Epstein-Barr virus infection     103562469 (TNF)    05165 Human papillomavirus infection     103562469 (TNF)   09171 Infectious disease: bacterial    05132 Salmonella infection     103562469 (TNF)    05135 Yersinia infection     103562469 (TNF)    05133 Pertussis     103562469 (TNF)    05134 Legionellosis     103562469 (TNF)    05152 Tuberculosis     103562469 (TNF)   09174 Infectious disease: parasitic    05146 Amoebiasis     103562469 (TNF)    05144 Malaria     103562469 (TNF)    05145 Toxoplasmosis     103562469 (TNF)    05140 Leishmaniasis     103562469 (TNF)    05142 Chagas disease     103562469 (TNF)    05143 African trypanosomiasis     103562469 (TNF)   09163 Immune disease    05310 Asthma     103562469 (TNF)    05322 Systemic lupus erythematosus     103562469 (TNF)    05323 Rheumatoid arthritis     103562469 (TNF)    05321 Inflammatory bowel disease     103562469 (TNF)    05330 Allograft rejection     103562469 (TNF)    05332 Graft-versus-host disease     103562469 (TNF)   09164 Neurodegenerative disease    05010 Alzheimer disease     103562469 (TNF)    05014 Amyotrophic lateral sclerosis     103562469 (TNF)    05020 Prion disease     103562469 (TNF)    05022 Pathways of neurodegeneration - multiple diseases     103562469 (TNF)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103562469 (TNF)    05418 Fluid shear stress and atherosclerosis     103562469 (TNF)    05410 Hypertrophic cardiomyopathy     103562469 (TNF)    05414 Dilated cardiomyopathy     103562469 (TNF)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     103562469 (TNF)    04940 Type I diabetes mellitus     103562469 (TNF)    04936 Alcoholic liver disease     103562469 (TNF)    04932 Non-alcoholic fatty liver disease     103562469 (TNF)    04931 Insulin resistance     103562469 (TNF)    04933 AGE-RAGE signaling pathway in diabetic complications     103562469 (TNF)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     103562469 (TNF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:epz04052]     103562469 (TNF)    00536 Glycosaminoglycan binding proteins [BR:epz00536]     103562469 (TNF) Cytokines and neuropeptides [BR:epz04052]  Cytokines   Tumor necrosis fators    103562469 (TNF) Glycosaminoglycan binding proteins [BR:epz00536]  Heparan sulfate / Heparin   Cytokines    103562469 (TNF) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  103562469 NCBI-ProteinID:  XP_008535731 UniProt:  A0ABM2FFH7 LinkDB All DBs Position 19:31797318..31800122 Genome browser AA seq 253 aa AA seqDB search MPQGSTISQLDLSPSGKDIMSTESMIRDVELAEEELAKKAGGPQGSRRCLCLSLFSFLLV AGATTLFCLLHFGVIGPQREEQLPNAFQSINPLAQTLRSSSRTPSDKPVAHVVANPQAEG QLQWLSGRANALLANGVKLTDNQLVVPLDGLYLIYSQVLFKGQGCPSTHVLLTHTISRLA VSYPSKVNLLSAIKSPCHTESPEQAEAKPWYEPIYLGGVFQLEKGDQLSAEINQPNYLDF AESGQVYFGIIAL NT seq 762 nt NT seq  +upstreamnt  +downstreamnt atgccccagggctcgaccatctcccagctggacttgagcccctctggaaaggacatcatg agcactgaaagcatgatccgagatgtggagctggcagaggaggagctcgccaagaaggca gggggcccccagggctccagacggtgcttgtgcctcagcctcttctccttcctccttgtc gcaggagccaccacgctcttctgcctgctgcactttggggtgatcggcccccagagggaa gagcagttaccgaatgccttccagtcaatcaaccctctggcccagacactcagatcatct tctcgaaccccaagtgacaagcctgtagcccatgttgtagcaaacccccaagccgagggg cagctccagtggctgagtgggcgtgcaaatgccctcctggccaatggcgtgaagctgaca gacaaccagctggtggtaccattggatgggctgtacctcatctactcccaggtcctcttc aaaggccaaggctgcccttccacccatgtgctcctcacccacaccatcagccgcttagct gtctcctacccgtccaaggtcaacctcctctctgccatcaagagcccttgccacacggag tccccagagcaggctgaagccaagccctggtatgagcccatctacctgggaggagtcttc cagctggagaagggtgatcaactcagcgctgagatcaatcagcccaactatctcgacttt gcggagtccgggcaggtctactttgggatcattgccctgtga

DBGET integrated database retrieval system