Equus przewalskii (Przewalski's horse): 103563147 Help Entry 103563147         CDS       T04644                                  Name (RefSeq) interferon beta-like   KO K05415   interferon beta Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz04060   Cytokine-cytokine receptor interaction epz04151   PI3K-Akt signaling pathway epz04217   Necroptosis epz04380   Osteoclast differentiation epz04620   Toll-like receptor signaling pathway epz04621   NOD-like receptor signaling pathway epz04622   RIG-I-like receptor signaling pathway epz04623   Cytosolic DNA-sensing pathway epz04630   JAK-STAT signaling pathway epz04650   Natural killer cell mediated cytotoxicity epz04668   TNF signaling pathway epz04936   Alcoholic liver disease epz05135   Yersinia infection epz05142   Chagas disease epz05152   Tuberculosis epz05160   Hepatitis C epz05161   Hepatitis B epz05162   Measles epz05163   Human cytomegalovirus infection epz05164   Influenza A epz05165   Human papillomavirus infection epz05167   Kaposi sarcoma-associated herpesvirus infection epz05168   Herpes simplex virus 1 infection epz05169   Epstein-Barr virus infection epz05170   Human immunodeficiency virus 1 infection epz05171   Coronavirus disease - COVID-19 epz05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:epz00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     103563147    04668 TNF signaling pathway     103563147    04151 PI3K-Akt signaling pathway     103563147   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103563147  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103563147  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103563147    04621 NOD-like receptor signaling pathway     103563147    04622 RIG-I-like receptor signaling pathway     103563147    04623 Cytosolic DNA-sensing pathway     103563147    04650 Natural killer cell mediated cytotoxicity     103563147   09158 Development and regeneration    04380 Osteoclast differentiation     103563147  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103563147    05161 Hepatitis B     103563147    05160 Hepatitis C     103563147    05171 Coronavirus disease - COVID-19     103563147    05164 Influenza A     103563147    05162 Measles     103563147    05168 Herpes simplex virus 1 infection     103563147    05163 Human cytomegalovirus infection     103563147    05167 Kaposi sarcoma-associated herpesvirus infection     103563147    05169 Epstein-Barr virus infection     103563147    05165 Human papillomavirus infection     103563147   09171 Infectious disease: bacterial    05135 Yersinia infection     103563147    05152 Tuberculosis     103563147   09174 Infectious disease: parasitic    05142 Chagas disease     103563147   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103563147   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     103563147  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:epz04052]     103563147 Cytokines and neuropeptides [BR:epz04052]  Cytokines   Interferons    103563147 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  103563147 NCBI-ProteinID:  XP_008536636 UniProt:  A0ABM2FHU5 LinkDB All DBs Position 22:complement(38418212..38418924) Genome browser AA seq 186 aa AA seqDB search MTYRWILPMALLLCVSTTALSVNYDLLRSQLRSSNSACQKLLRQLNGAPQRCPEDTMNFQ VPEEIEQAQQFQKEDAALVIYEMLQHTLRIFRRNFASTGWNETIVENLLVKVHLQMDRLE TNLEEIMEEESSTWGNTTILRLKKYYGRIVQYLKAKKYSHCAWTVVQAEMLRSLAFLNGL IDYLQN NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacctacaggtggatcctcccaatggccctcctgctgtgtgtctccaccacggctctt tctgtgaactatgacttgcttcggtcccaactaagaagcagcaattcagcatgtcagaag ctcctgcggcagttgaatggagcccctcaacgttgccccgaggacacaatgaacttccag gtccctgaggagattgagcaagcacagcagtttcagaaggaggatgccgcattggtcatc tatgagatgctccagcacaccttgcgtattttcagaagaaatttcgctagcactggctgg aatgagaccatcgttgagaacctccttgtgaaagtccatctgcagatggaccgtctggag acaaacctggaggaaataatggaggaggaaagctccacctggggaaacacaaccattctg cgcctgaagaaatactacggaaggatcgtgcagtacctgaaggccaagaagtacagccac tgtgcctggacggtggtccaagcggaaatgctcagaagcttggccttccttaacggactc atagattacctccaaaactga

DBGET integrated database retrieval system