Equus przewalskii (Przewalski's horse): 103563148 Help Entry 103563148         CDS       T04644                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz04060   Cytokine-cytokine receptor interaction epz04151   PI3K-Akt signaling pathway epz04217   Necroptosis epz04380   Osteoclast differentiation epz04620   Toll-like receptor signaling pathway epz04621   NOD-like receptor signaling pathway epz04622   RIG-I-like receptor signaling pathway epz04623   Cytosolic DNA-sensing pathway epz04630   JAK-STAT signaling pathway epz04650   Natural killer cell mediated cytotoxicity epz04668   TNF signaling pathway epz04936   Alcoholic liver disease epz05135   Yersinia infection epz05142   Chagas disease epz05152   Tuberculosis epz05160   Hepatitis C epz05161   Hepatitis B epz05162   Measles epz05163   Human cytomegalovirus infection epz05164   Influenza A epz05165   Human papillomavirus infection epz05167   Kaposi sarcoma-associated herpesvirus infection epz05168   Herpes simplex virus 1 infection epz05169   Epstein-Barr virus infection epz05170   Human immunodeficiency virus 1 infection epz05171   Coronavirus disease - COVID-19 epz05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:epz00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     103563148 (IFNB1)    04668 TNF signaling pathway     103563148 (IFNB1)    04151 PI3K-Akt signaling pathway     103563148 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103563148 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103563148 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103563148 (IFNB1)    04621 NOD-like receptor signaling pathway     103563148 (IFNB1)    04622 RIG-I-like receptor signaling pathway     103563148 (IFNB1)    04623 Cytosolic DNA-sensing pathway     103563148 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     103563148 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     103563148 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103563148 (IFNB1)    05161 Hepatitis B     103563148 (IFNB1)    05160 Hepatitis C     103563148 (IFNB1)    05171 Coronavirus disease - COVID-19     103563148 (IFNB1)    05164 Influenza A     103563148 (IFNB1)    05162 Measles     103563148 (IFNB1)    05168 Herpes simplex virus 1 infection     103563148 (IFNB1)    05163 Human cytomegalovirus infection     103563148 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     103563148 (IFNB1)    05169 Epstein-Barr virus infection     103563148 (IFNB1)    05165 Human papillomavirus infection     103563148 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     103563148 (IFNB1)    05152 Tuberculosis     103563148 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     103563148 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103563148 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     103563148 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:epz04052]     103563148 (IFNB1) Cytokines and neuropeptides [BR:epz04052]  Cytokines   Interferons    103563148 (IFNB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  103563148 NCBI-ProteinID:  XP_008536637 LinkDB All DBs Position 22:complement(38371226..38371954) Genome browser AA seq 186 aa AA seqDB search MTYRWILPMALLLCFSTTALSVNYDLLRSQLRSSNSACLMLLRQLNGAPQRCPEDTMNFQ VPEEIEQAQQFQKEDAALVIYEMLQHTWRIFRRNFASTGWNETIVKNLLVEVHLQMDHLE TNLEEIMEEESSTWGNTTILRLKKYYGRISQYLKAKKYSHCAWTVVQAEMLRNLAFLNGL TDYLQN NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacctacaggtggatcctcccaatggccctcctgctgtgtttctccaccacggctctt tctgtgaactatgacttgcttcggtcccaactaagaagcagcaattcagcatgtctgatg ctcctgcggcagttgaatggagcccctcaacgttgccccgaggacacaatgaacttccag gtccctgaggagattgagcaagcacagcagttccagaaggaggatgctgcattggtcatc tatgagatgctccagcacacctggcgtattttcagaagaaattttgctagcactggctgg aatgagaccatcgttaagaacctccttgtggaagtccatctgcagatggaccatctggag acaaacctggaggaaataatggaggaggaaagctccacctggggaaacacgaccattctg cgcctgaagaaatactacggaaggatctcgcagtacctgaaggccaagaagtacagccac tgtgcctggacagtggtccaagcggaaatgctcaggaacttggccttccttaacggactc acagattacctccaaaactga

DBGET integrated database retrieval system