Exiguobacterium sibiricum: Exig_0061 Help Entry Exig_0061         CDS       T00687                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism esi  Exiguobacterium sibiricum Pathway esi00790   Folate biosynthesis esi01100   Metabolic pathways esi01240   Biosynthesis of cofactors Module esi_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:esi00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Exig_0061 Enzymes [BR:esi01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Exig_0061  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Exig_0061  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Exig_0061 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ACB59548 UniProt:  B1YGR5 LinkDB All DBs Position 78543..78914 Genome browser AA seq 123 aa AA seqDB search MDRIEVTGMRFYGYHGVFAEETKLGQRFNVDLSIGLDLLRAGQTDDLRESVNYAELYEVT KQVVEGTPLQLVEALANRIAEQVLALDNRILETTVKVIKPDPPIAGHYEHVAVEIHRKRA DYL NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atggatcgaatcgaagtgacagggatgcgtttttacggataccatggtgtgtttgcggaa gagacgaagctcggtcagcgcttcaatgtggatttatcaattggccttgatttgttgcgt gccggtcaaaccgatgatttacgggaaagtgtgaattatgctgaattatacgaagtgaca aagcaggttgtcgaaggaacgccgttgcaattggtcgaagccttggcgaatcggattgcg gaacaggttttggcactcgataaccggattcttgaaacgaccgtcaaagtcatcaaaccg gatccgccgattgccggacattatgaacatgtcgcggttgaaatccaccggaagcgggcg gattacttatga

DBGET integrated database retrieval system