Euwallacea similis: 136419195 Help Entry 136419195         CDS       T10684                                  Symbol kud Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism esim  Euwallacea similis Pathway esim00510   N-Glycan biosynthesis esim00513   Various types of N-glycan biosynthesis esim04141   Protein processing in endoplasmic reticulum Module esim_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:esim00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     136419195 (kud)    00513 Various types of N-glycan biosynthesis     136419195 (kud)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     136419195 (kud) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 TctB DUF6512 CAAD TrbL_3 PRA1 DUF6338 DUF485 LapA_dom DUF202 Motif Other DBs NCBI-GeneID:  136419195 NCBI-ProteinID:  XP_066261494 LinkDB All DBs Position 2:complement(8004954..8005618) Genome browser AA seq 80 aa AA seqDB search MADTGKLIRYSSPVNPAVFPHLTLVLLGIGIFFTAWFFVYEVTSNKQTRSLKKEIATALV ASIFSGFGIVFLLLTVGIYV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggccgatacaggaaaactaataagatactcctcacctgtgaacccagcagttttcccc catttaacgttggtcctattaggaataggcatattcttcacggcctggtttttcgtttac gaagtgacgagcaataagcaaacacgaagcctaaagaaggaaattgccactgccttggtt gcttcaattttctcgggttttggcattgtgttccttctcttaactgtggggatttatgtg tga

DBGET integrated database retrieval system