Escherichia sp. E4742: FEM44_14735 Help Entry FEM44_14735       CDS       T06276                                  Symbol folA Name (GenBank) type 3 dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism esz  Escherichia sp. E4742 Pathway esz00670   One carbon pool by folate esz00790   Folate biosynthesis esz01100   Metabolic pathways esz01240   Biosynthesis of cofactors esz04981   Folate transport and metabolism Module esz_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:esz00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     FEM44_14735 (folA)    00670 One carbon pool by folate     FEM44_14735 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     FEM44_14735 (folA) Enzymes [BR:esz01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      FEM44_14735 (folA) SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  QCT88347 LinkDB All DBs Position 3020086..3020565 Genome browser AA seq 159 aa AA seqDB search MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVIMGRHTWESIGRPLPGRKNI VISSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE GDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgatcagtttgattgcggcgctagcggtagatcgcgttatcggcatggaaaacgccatg ccctggaatctgcctgccgatctcgcctggtttaaacgtaacaccttaaataaacctgtg attatgggccgccatacttgggaatccatcggccgcccgctacctggacgcaagaatatt gtcatcagcagccagccgggtacggacgatcgcgtaacgtgggtgaaatcggttgatgaa gccattgcggcgtgtggtgacgtaccagaaattatggtgattggcggcggtcgcgtttat gagcagttcctgccgaaagcgcaaaaactgtatctgacgcatatcgatgcagaagtggaa ggcgacacccatttcccggattacgagccggatgactgggaatcggtattcagcgaattc cacgacgccgacgcgcagaactctcatagctattgctttgagattctggaacgacggtaa

DBGET integrated database retrieval system