Empidonax traillii (willow flycatcher): 114058064 Help Entry 114058064         CDS       T05887                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism etl  Empidonax traillii (willow flycatcher) Pathway etl03420   Nucleotide excision repair etl04110   Cell cycle etl04114   Oocyte meiosis etl04120   Ubiquitin mediated proteolysis etl04141   Protein processing in endoplasmic reticulum etl04310   Wnt signaling pathway etl04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:etl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     114058064 (RBX1)    04120 Ubiquitin mediated proteolysis     114058064 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     114058064 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     114058064 (RBX1)    04350 TGF-beta signaling pathway     114058064 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:etl04121]     114058064 (RBX1)    03400 DNA repair and recombination proteins [BR:etl03400]     114058064 (RBX1) Enzymes [BR:etl01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      114058064 (RBX1) Ubiquitin system [BR:etl04121]  Ubiquitin ligases (E3)   UBL E3 ligases    114058064 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      114058064 (RBX1)    Cul2 complex      114058064 (RBX1)    Cul3 complex      114058064 (RBX1)    Cul4 complex      114058064 (RBX1)    Cul7 complex      114058064 (RBX1)    Cul8 complex      114058064 (RBX1)    Cul9 complex      114058064 (RBX1) DNA repair and recombination proteins [BR:etl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       114058064 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       114058064 (RBX1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  114058064 NCBI-ProteinID:  XP_027740838 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAAAMDVDTPSATNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggccgcgatggatgtggacacccccagcgccaccaacagcggcgccggcaagaag cgcttcgaagtgaagaaatggaacgccgtagctctgtgggcatgggacattgtggttgat aactgtgccatttgcagaaaccacattatggatctatgcatagaatgtcaagcaaaccaa gcatcggctacctctgaagagtgcacagttgcatggggcgtctgcaatcatgctttccac ttccactgcatctctcgctggctcaaaactcgccaagtatgtccgctggacaacagggaa tgggagttccaaaagtatggacactag

DBGET integrated database retrieval system