Empidonax traillii (willow flycatcher): 114062162 Help Entry 114062162         CDS       T05887                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism etl  Empidonax traillii (willow flycatcher) Pathway etl03050   Proteasome etl04060   Cytokine-cytokine receptor interaction etl04217   Necroptosis etl04350   TGF-beta signaling pathway etl05164   Influenza A etl05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:etl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     114062162 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     114062162 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     114062162 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     114062162 (IFNG)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     114062162 (IFNG)    05168 Herpes simplex virus 1 infection     114062162 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:etl03051]     114062162 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:etl04052]     114062162 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:etl00536]     114062162 (IFNG) Proteasome [BR:etl03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     114062162 (IFNG) Cytokines and neuropeptides [BR:etl04052]  Cytokines   Interferons    114062162 (IFNG) Glycosaminoglycan binding proteins [BR:etl00536]  Heparan sulfate / Heparin   Cytokines    114062162 (IFNG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma Lipoprotein_20 Sec8_N Transglut_prok DUF948 Motif Other DBs NCBI-GeneID:  114062162 NCBI-ProteinID:  XP_027749097 LinkDB All DBs Position Unknown AA seq 165 aa AA seqDB search MPVQTYSLFVLTIIMIYFGRVENRFNLLQLQDDIDKLKADFNSSHSDVGDGRPIFTGRLS NWTERNEKRIILSQIVSMYLKILENTDKSKAHVRNITEELYTLKESLSDGSKKMEYLKDL TKLQVNDLKIQRKAVNELFSVLQKLGDTPSSYKRKRSQFQRQCKC NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atgcctgtccaaacctacagcttgtttgttctgactatcatcatgatttattttggacgt gttgaaaatagatttaatctgcttcaacttcaagatgatatagacaaactgaaagctgat tttaactcaagtcattcagatgtaggtgatggcagaccaatctttacggggagattgtca aactggacagagagaaatgaaaaaaggatcatcctgagtcagattgtttccatgtacttg aaaatccttgaaaatactgacaagtcaaaggcgcatgtcaggaacataactgaggagctc tacactctgaaagaaagcctttctgatggctcaaagaagatggaatatctcaaggacctg acaaagcttcaggtgaatgacttgaaaattcaacgtaaagctgtgaatgagctgttcagc gtcttacaaaaactgggagatactccaagttcttacaaaagaaaaagaagccagtttcag aggcagtgcaaatgctaa

DBGET integrated database retrieval system