Empidonax traillii (willow flycatcher): 114063361 Help Entry 114063361         CDS       T05887                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism etl  Empidonax traillii (willow flycatcher) Pathway etl00510   N-Glycan biosynthesis etl00513   Various types of N-glycan biosynthesis etl04141   Protein processing in endoplasmic reticulum Module etl_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:etl00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     114063361 (TMEM258)    00513 Various types of N-glycan biosynthesis     114063361 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     114063361 (TMEM258) SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 Phage_holin_3_3 TctB Motif Other DBs NCBI-GeneID:  114063361 NCBI-ProteinID:  XP_027751372 LinkDB All DBs Position Unknown AA seq 74 aa AA seqDB search MSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMG FGVLFLLLWVGIYV NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgagcagatacaccagcccggtgaacccggccgtattcccgcacctcaccgtggtgctg ctggccatcggcatgttcttcactgcctggttcttcgtctacgaggtgacatccaccaag tacacgcgggacatctacaaggagctgctgatctcgttggtggcctcgctcttcatgggc ttcggagtcctgttcctgctgctctgggtcgggatctatgtgtga

DBGET integrated database retrieval system