Filifactor alocis: HMPREF0389_00904
Help
Entry
HMPREF0389_00904 CDS
T01663
Name
(GenBank) putative 3-oxoacyl-[acyl-carrier-protein] reductase
KO
K00059
3-oxoacyl-[acyl-carrier protein] reductase [EC:
1.1.1.100
]
Organism
faa
Filifactor alocis
Pathway
faa00061
Fatty acid biosynthesis
faa00780
Biotin metabolism
faa01100
Metabolic pathways
faa01110
Biosynthesis of secondary metabolites
faa01212
Fatty acid metabolism
faa01240
Biosynthesis of cofactors
Module
faa_M00083
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:
faa00001
]
09100 Metabolism
09103 Lipid metabolism
00061 Fatty acid biosynthesis
HMPREF0389_00904
09108 Metabolism of cofactors and vitamins
00780 Biotin metabolism
HMPREF0389_00904
09110 Biosynthesis of other secondary metabolites
00333 Prodigiosin biosynthesis
HMPREF0389_00904
09180 Brite Hierarchies
09181 Protein families: metabolism
01004 Lipid biosynthesis proteins [BR:
faa01004
]
HMPREF0389_00904
Enzymes [BR:
faa01000
]
1. Oxidoreductases
1.1 Acting on the CH-OH group of donors
1.1.1 With NAD+ or NADP+ as acceptor
1.1.1.100 3-oxoacyl-[acyl-carrier-protein] reductase
HMPREF0389_00904
Lipid biosynthesis proteins [BR:
faa01004
]
Fatty acid synthase
Component type
HMPREF0389_00904
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
adh_short_C2
adh_short
KR
SDR
NmrA
Polysacc_synt_2
Epimerase
3HCDH_N
Motif
Other DBs
NCBI-ProteinID:
EFE28982
UniProt:
D6GQC9
LinkDB
All DBs
Position
complement(1530299..1531063)
Genome browser
AA seq
254 aa
AA seq
DB search
MKDKVVIITGGSKGIGLGIVTVFAKEQAKVVFTGRNEETGKQTQQQLKEQGLDTLFLASD
VSDESSMRNLMKQVYDTYGRIDILLHNAGIYPEVKLVDMTLEDWDKVHNINLRGTFIAIK
EVIPYMKQQNKGKIVITSSITGPKTGNPGLAHYAASKAGVNGLIRTACLELAPWNINVNG
VEPGNIMTPGMTDVLGEEYIKAQEASIPSGKLGVPEDIAYAAMFLASEEANYITGQTIVV
DGGQILPESKLEIN
NT seq
765 nt
NT seq
+upstream
nt +downstream
nt
atgaaagacaaggtagttattattaccggaggaagtaagggaatcggacttggaattgtg
actgtatttgcaaaagagcaagcaaaagttgtttttaccggaagaaatgaagagaccgga
aagcagacacaacaacagttgaaagaacaaggattggatactctgtttcttgcatcggat
gtcagtgatgaatcctctatgagaaacttgatgaaacaagtttatgatacctatggcaga
attgatattttgttgcacaatgcggggatttatccggaagtgaaattggtggatatgaca
ttggaagattgggataaggtacacaatattaacttgagaggaactttcattgcaatcaaa
gaagttattccgtatatgaagcaacagaacaaaggcaaaattgtaatcacatcttctatt
acgggaccgaaaacagggaatccgggattagcacattatgcggcaagcaaggcaggagtc
aacggtttgattcgtaccgcctgtttggaacttgcaccatggaacatcaatgtaaacggt
gtggaaccgggaaatattatgacaccgggaatgacggatgtgcttggagaagaatatatc
aaagcacaggaagcatccattccatccgggaaattgggagtaccggaagatattgcctat
gcagcaatgtttttggcatcagaggaagcgaattatattaccggacagactattgttgtg
gatggtggacaaattttaccggaatcgaagttggaaattaattaa
DBGET
integrated database retrieval system