KEGG   Felis catus (domestic cat): 100135772
Entry
100135772         CDS       T02385                                 
Symbol
FGF2
Name
(RefSeq) LOW QUALITY PROTEIN: fibroblast growth factor 2
  KO
K18497  fibroblast growth factor 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04810  Regulation of actin cytoskeleton
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05207  Chemical carcinogenesis - receptor activation
fca05218  Melanoma
fca05224  Breast cancer
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100135772 (FGF2)
   04014 Ras signaling pathway
    100135772 (FGF2)
   04015 Rap1 signaling pathway
    100135772 (FGF2)
   04020 Calcium signaling pathway
    100135772 (FGF2)
   04151 PI3K-Akt signaling pathway
    100135772 (FGF2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100135772 (FGF2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100135772 (FGF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100135772 (FGF2)
   05205 Proteoglycans in cancer
    100135772 (FGF2)
   05207 Chemical carcinogenesis - receptor activation
    100135772 (FGF2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100135772 (FGF2)
   05218 Melanoma
    100135772 (FGF2)
   05224 Breast cancer
    100135772 (FGF2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100135772 (FGF2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100135772 (FGF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    100135772 (FGF2)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    100135772 (FGF2)
Cytokines and growth factors [BR:fca04052]
 Growth factors
  Growth factors (RTK binding)
   100135772 (FGF2)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100135772 (FGF2)
SSDB
Motif
Pfam: FGF IL1 Fascin
Other DBs
NCBI-GeneID: 100135772
NCBI-ProteinID: XP_023109163
LinkDB
Position
B1:complement(103650704..103712771)
AA seq 337 aa
MCSAGWAWGDFWGTSRGRAPRVAEAPGGRLPAPERVGGGAQEGRRAGGVRGWWVFGGGDV
QDVTPRPGRGQSGGRGARGCSRNPGAVAWRGGPPERRPRRHPALSPGSRAPRRTALQGRR
GGERPRGATLGXRGRGRAPPGGRLGGRGRGRAPDRVGGRGRRTAAPRAAPGARAPRQGPG
GAMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDP
HIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSR
KYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgtgctcggcagggtgggcctggggcgacttctggggaactagccggggtcgagcccct
agagttgcggaggccccgggcggtcgcctcccggctcccgagcgagtagggggcggcgcg
caggaagggaggagggccgggggcgtgcggggttggtgggtgttcgggggtggagatgta
caagatgtgacgccgcggccgggccggggccagagcggcggacgcggtgcccgcggttgc
agccggaacccgggcgctgtagcttggagaggcggccctccggagcggcggccgcgaaga
cacccagccctaagccccggctcccgagcgccgcggcgcaccgcgctccagggcagacgc
ggaggggagcggccgagaggcgcgacgctggggncccgcgggcgcggtcgcgcgccgccg
ggcgggaggctggggggccggggccggggccgtgccccggaccgggtcgggggccggggc
cggaggacggcggctccccgcgcggctcctggggcgcgggcaccccggcagggccccggg
ggggccatggcagccgggagcatcaccacgctgcccgccctgccggaggacggcggcagc
ggcgctttcccgcccggccacttcaaggaccccaagcgtctgtactgcaaaaacgggggc
ttcttcctgcgcatccaccccgacggccgagtggatggggtccgggagaagagcgaccct
cacatcaaactgcaacttcaggcagaagagagaggggttgtgtccatcaaaggagtctgt
gcaaaccgctatcttgccatgaaggaagatggaagattactggcttctaaatgtgttacg
gacgagtgtttcttttttgaacgattggaatctaataactacaatacttatcggtcaagg
aaatactccagctggtatgtggcactgaaacgaactgggcagtataaacttggacccaaa
acaggacctgggcagaaagctatactttttcttccaatgtctgctaagagctga

DBGET integrated database retrieval system