KEGG   Felis catus (domestic cat): 100142684
Entry
100142684         CDS       T02385                                 
Symbol
CASP8
Name
(RefSeq) caspase-8 isoform X1
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01524  Platinum drug resistance
fca04115  p53 signaling pathway
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca04217  Necroptosis
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04668  TNF signaling pathway
fca04932  Non-alcoholic fatty liver disease
fca04936  Alcoholic liver disease
fca05010  Alzheimer disease
fca05016  Huntington disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05132  Salmonella infection
fca05134  Legionellosis
fca05142  Chagas disease
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05416  Viral myocarditis
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100142684 (CASP8)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100142684 (CASP8)
   04215 Apoptosis - multiple species
    100142684 (CASP8)
   04217 Necroptosis
    100142684 (CASP8)
   04115 p53 signaling pathway
    100142684 (CASP8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100142684 (CASP8)
   04621 NOD-like receptor signaling pathway
    100142684 (CASP8)
   04622 RIG-I-like receptor signaling pathway
    100142684 (CASP8)
   04625 C-type lectin receptor signaling pathway
    100142684 (CASP8)
   04657 IL-17 signaling pathway
    100142684 (CASP8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100142684 (CASP8)
   05203 Viral carcinogenesis
    100142684 (CASP8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100142684 (CASP8)
   05161 Hepatitis B
    100142684 (CASP8)
   05160 Hepatitis C
    100142684 (CASP8)
   05164 Influenza A
    100142684 (CASP8)
   05162 Measles
    100142684 (CASP8)
   05168 Herpes simplex virus 1 infection
    100142684 (CASP8)
   05163 Human cytomegalovirus infection
    100142684 (CASP8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100142684 (CASP8)
   05169 Epstein-Barr virus infection
    100142684 (CASP8)
   05165 Human papillomavirus infection
    100142684 (CASP8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100142684 (CASP8)
   05134 Legionellosis
    100142684 (CASP8)
   05152 Tuberculosis
    100142684 (CASP8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100142684 (CASP8)
   05142 Chagas disease
    100142684 (CASP8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100142684 (CASP8)
   05016 Huntington disease
    100142684 (CASP8)
   05022 Pathways of neurodegeneration - multiple diseases
    100142684 (CASP8)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100142684 (CASP8)
   05416 Viral myocarditis
    100142684 (CASP8)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100142684 (CASP8)
   04932 Non-alcoholic fatty liver disease
    100142684 (CASP8)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100142684 (CASP8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    100142684 (CASP8)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     100142684 (CASP8)
Peptidases and inhibitors [BR:fca01002]
 Cysteine peptidases
  Family C14: caspase family
   100142684 (CASP8)
SSDB
Motif
Pfam: DED Peptidase_C14 PYRIN
Other DBs
NCBI-GeneID: 100142684
NCBI-ProteinID: XP_006935535
Ensembl: ENSFCAG00000025854
UniProt: A0A5F5XMX6
LinkDB
Position
C1:188224524..188248986
AA seq 479 aa
MDFSKCLYNIGEQLGSDELASLKFLSLDYIPQKKQEPIKDALMLFQRLQEKRMLEESNLS
FLKELLFRINRLDLLFNYLNTSKEAMEQELQIPGRAQIPPYRVMLFQISEDVNKLELRSF
KFLLSQEISRCKVDDDMNLLDIFIEMEKRVILGERNLDTLKRICDQINKSLLKKITDYEE
LSREGRTSLQRSPDELSNGEESLAMMALSDSLEEQDSESQTSDKVYRMKSKPRGYCLIFN
NYDFSRARKDVPKLQNIKDRNGTNFDAEALSKTFSELHFEIVNFKDSTAKTICEVLKSYQ
RMDHNNKDCFICCILSHGDKGIIYGSDGQEAPIYELTSYFTGSKCPSLAGKPKIFFIQAC
QGDNYQRGIAVETDSEQKEDYLEMDSSFQKRYIPDEADFLLGMATVNNCVSYRNPTEGTW
YIQSLCQSLRERCPRGEDILTILTEVNFEVSNKDDKKNMGKQMPQPTFTLRKKLFFPLN
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggatttcagtaaatgtctgtataatattggggaacagctgggcagtgacgagctggcc
tccctcaaattcctgagcctggactacatcccacaaaagaagcaagaacccatcaaagat
gccttgatgttattccagagactccaggaaaagagaatgttggaggaaagcaacttgtcc
ttcttgaaggagctgcttttccgaattaatagactggacctgctgttcaactacctgaac
accagcaaggaagcgatggagcaggagcttcagataccaggcagagcccagatccctccc
tacagggtcatgctttttcagatttcagaagatgtaaacaaattggaattgaggtcgttt
aagtttcttttgagccaggagatctccagatgtaaagtggatgatgatatgaacttgctt
gatattttcatagagatggaaaagagggtcatcctaggggaaagaaatttggacactctg
aaaagaatctgtgaccaaatcaacaagagcctgctgaagaaaatcactgattatgaagaa
ttaagcagagagggaagaacgagccttcaaagaagtccagatgaattgtcaaatggggag
gaatccctggcaatgatggcattatcggactctctagaagaacaggacagtgagtcacag
acatcggacaaagtttaccgaatgaaaagcaaacctcgcggatattgtttgatctttaac
aattatgattttagcagagcacggaaggatgtgcccaaacttcagaacattaaggatagg
aatggaacaaacttcgatgcagaagctttgagtaagacctttagtgagcttcattttgag
attgtgaatttcaaagactctacagcaaagacaatctgtgaagttctgaaatcctaccaa
agaatggaccataataacaaagattgcttcatctgctgtatcctctcccatggagacaaa
ggcattatttatggctctgatgggcaggaagcccccatctatgagctgacttcttacttc
actggttcaaagtgcccttcccttgcaggcaagcccaaaatcttttttattcaggcttgt
caaggggataactaccagagaggtatagctgttgagactgactccgaacagaaggaagac
tacttagaaatggactcatcatttcagaagagatatatcccagatgaggctgattttctg
ctggggatggccactgtgaacaactgtgtttcctaccgaaaccctacggaggggacctgg
tatatccagtcactttgccagagcctaagagaaagatgtcctaggggtgaagatatcctc
accatccttactgaggtgaactttgaagtgagcaataaggatgacaagaaaaacatgggg
aaacaaatgccacaacctactttcacactgaggaaaaaactcttcttccctcttaattga

DBGET integrated database retrieval system