KEGG   Felis catus (domestic cat): 100316614
Entry
100316614         CDS       T02385                                 
Symbol
VDR
Name
(RefSeq) vitamin D3 receptor isoform X2
  KO
K08539  vitamin D3 receptor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04978  Mineral absorption
fca05152  Tuberculosis
fca05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100316614 (VDR)
  09154 Digestive system
   04978 Mineral absorption
    100316614 (VDR)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100316614 (VDR)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    100316614 (VDR)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100316614 (VDR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    100316614 (VDR)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    100316614 (VDR)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:fca03310]
    100316614 (VDR)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100316614 (VDR)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    100316614 (VDR)
Nuclear receptors [BR:fca03310]
 1. Thyroid hormone like
  1I. Vitamin D3 like receptor
   100316614 (VDR)
SSDB
Motif
Pfam: zf-C4 Hormone_recep zf-RRPl_C4
Other DBs
NCBI-GeneID: 100316614
NCBI-ProteinID: XP_003988645
Ensembl: ENSFCAG00000024594
LinkDB
Position
B4:complement(76745212..76803040)
AA seq 424 aa
MAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFN
GDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLRPK
LSEEQQRIITILLDAHHKTYDPTYADFTQFRPPVRGDACGGGHPSRPSSRHTPSLSGDSS
STCSDHYAASLDVMEPTSFSNLDPREEDSDDPSVTLDLSQLSMLPHLADLVSYSIQKVIG
FAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNQSFLIDDMSWTCGSQDYKYRISDVTKA
GHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALVEAIQDRLSNTL
QTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLEVFG
NEIS
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggcagccagcacttccctgcctgaccctggcgactttgaccggaatgtgccccgaatc
tgtggggtgtgcggagaccgagccaccggctttcacttcaacgctatgacctgtgaaggc
tgcaaaggcttcttcaggcgaagcatgaagcggaaggcgctgttcacctgcccctttaac
ggcgactgccgcatcaccaaggacaatcgccgccactgccaggcgtgccggctcaagcgc
tgtgtggacatcggcatgatgaaggagttcatcctgacagacgaagaggtacagcggaag
cgggagatgatcctgaagcggaaggaggaggaagccttgaaggacagtctgcggcccaag
ctctcggaggagcagcagcgcatcatcaccatcctgctggatgcccaccacaagacctat
gaccccacctatgctgactttacccagttccggcctccggttcgtggggatgcgtgcggc
ggcggccatccctcaaggccctcctccagacacacgcccagcctctccggggactcgtct
tccacctgctcagatcactacgcggcctcgctcgatgtgatggagccgaccagcttctcc
aatctggatccgagggaagaggattcagatgacccttctgtgaccctggacctgtcccag
ctctcgatgctgccccacctggctgacctggtcagttacagcatccaaaaggtcatcggc
tttgccaagatgattccagggttcagagacctcacttctgaggaccagattgtgctgctg
aagtcaagtgccattgaggtcatcatgttgcgctctaaccagtccttcctcatagatgac
atgtcctggacctgtggcagccaggactataagtaccgcatcagtgatgtgaccaaagct
ggacacagcctggagctgattgagcccctcatcaagttccaggtggggctgaagaagctg
aacttgcatgaggaggagcatgtcctgctcatggccatctgcattgtctccccagaccgt
cctggcgtgcaggatgctgcgctggtcgaggccatccaggaccgcctgtccaacacattg
cagacctacatccgctgccgccacccaccccccggcagccacctactctacgccaagatg
atccagaagctagctgacctgcgtagcctcaatgaggagcactccaagcagtaccgctgc
ctctccttccagcctgagtgcagcatgaagctcacaccgctggtgctggaggtgtttggc
aacgagatttcctga

DBGET integrated database retrieval system