Felis catus (domestic cat): 100462978 Help Entry 100462978         CDS       T02385                                  Symbol CD209 Name (RefSeq) CD209 antigen   KO K06563   C-type lectin domain family 4 member L/M Organism fca  Felis catus (domestic cat) Pathway fca03260   Virion - Human immunodeficiency virus fca03264   Virion - Flavivirus and Alphavirus fca03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus fca03273   Virion - Lassa virus and SFTS virus fca04145   Phagocytosis fca04517   IgSF CAM signaling fca04625   C-type lectin receptor signaling pathway fca05152   Tuberculosis fca05162   Measles Brite KEGG Orthology (KO) [BR:fca00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     100462978 (CD209)    03264 Virion - Flavivirus and Alphavirus     100462978 (CD209)    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     100462978 (CD209)    03273 Virion - Lassa virus and SFTS virus     100462978 (CD209)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     100462978 (CD209)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     100462978 (CD209)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100462978 (CD209)  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     100462978 (CD209)   09171 Infectious disease: bacterial    05152 Tuberculosis     100462978 (CD209)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fca04131]     100462978 (CD209)   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:fca04054]     100462978 (CD209)    04515 Cell adhesion molecules [BR:fca04515]     100462978 (CD209)    04090 CD molecules [BR:fca04090]     100462978 (CD209)    04091 Lectins [BR:fca04091]     100462978 (CD209) Membrane trafficking [BR:fca04131]  Endocytosis   Phagocytosis    C-lectin receptors     100462978 (CD209) Pattern recognition receptors [BR:fca04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    100462978 (CD209) Cell adhesion molecules [BR:fca04515]  Lectins   Selectins and C-type lectins    100462978 (CD209) CD molecules [BR:fca04090]  Proteins   100462978 (CD209) Lectins [BR:fca04091]  C-Type lectins   Asialoglycoprotein and DC receptors    100462978 (CD209) SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Peptidase_S15 PPI_helical UL45 Motif Other DBs NCBI-GeneID:  100462978 NCBI-ProteinID:  XP_003981851 UniProt:  A0ABI8AMS5 LinkDB All DBs Position A2:6044166..6047708 Genome browser AA seq 254 aa AA seqDB search MAEMCDPKEPDDPEVEVFGDQRLAKKYTGLLRSSRSLPGCLTQAHLPLLLLLVSLGFFML LVTTLVQVSRIHQSLQRDTGDHRERNHQESPGLGDVSQAQKQSSLEEILQQLTWMNATLA GLCRHCPWKWELFQGSCYFFSLTQNTWKESIAACQNMRAQLVVINSTEEQKFLKSWNTKN SQRTWIGLSDHHNEGSWRWVDNTPLQLSFWKEGEPNNHGDEDCVELYSDGWNDNRCSTEN FWICKKPSSPCPGL NT seq 765 nt NT seq  +upstreamnt  +downstreamnt atggcggagatgtgtgaccccaaggagccggatgaccccgaggtggaggtgtttggggac cagagactggctaagaaatacaccggcctgctcaggagctcacggagcctgccagggtgt ctgacccaggcccacctgcctctgctgctgcttcttgtctccctgggcttcttcatgctc ctggtgaccactctggttcaagtctccaggatccaccaatccctgcagagagacacaggg gaccatcgggagaggaaccatcaggagagccccggcctcggggatgtttctcaggcccag aaacaatcatccctggaggagatactccagcagctgacctggatgaatgccaccctggct ggcctgtgccgccactgcccctggaaatgggaacttttccagggaagctgctacttcttc tccctgacccagaacacctggaaagagtccatcgccgcgtgtcagaacatgagggcccag ctggtggtcatcaacagcactgaggagcagaaatttctgaagtcttggaatacgaaaaat agccagcgcacatggatcggcctcagtgaccaccacaatgagggttcttggagatgggtg gacaacactcccctccaactcagcttctggaaagaaggggaacccaacaaccacggggat gaggactgtgtggaattgtacagtgacggctggaatgacaacagatgtagtacagaaaac ttctggatctgtaagaagccctcgtccccctgcccgggcctctga

DBGET integrated database retrieval system