KEGG   Felis catus (domestic cat): 100462978
Entry
100462978         CDS       T02385                                 
Symbol
CD209
Name
(RefSeq) CD209 antigen
  KO
K06563  C-type lectin domain family 4 member M
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04625  C-type lectin receptor signaling pathway
fca05152  Tuberculosis
fca05162  Measles
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100462978 (CD209)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100462978 (CD209)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100462978 (CD209)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100462978 (CD209)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    100462978 (CD209)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:fca04054]
    100462978 (CD209)
   04090 CD molecules [BR:fca04090]
    100462978 (CD209)
   04091 Lectins [BR:fca04091]
    100462978 (CD209)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    100462978 (CD209)
Pattern recognition receptors [BR:fca04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   100462978 (CD209)
CD molecules [BR:fca04090]
 Proteins
  100462978 (CD209)
Lectins [BR:fca04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    100462978 (CD209)
SSDB
Motif
Pfam: Lectin_C
Other DBs
NCBI-GeneID: 100462978
NCBI-ProteinID: XP_003981851
Ensembl: ENSFCAG00000023117
LinkDB
Position
A2:6076036..6079557
AA seq 254 aa
MAEMCDPKEPDDPEVEVFGDQRLAKKYTGLLRSSRSLPGCLTQAHLPLLLLLVSLGFFML
LVTTLVQVSRIHQSLQRDTGDHRERNHQESPGLGDVSQAQKQSSLEEILQQLTWMNATLA
GLCRHCPWKWELFQGSCYFFSLTQNTWKESIAACQNMRAQLVVINSTEEQKFLKSWNTKN
SQRTWIGLSDHHNEGSWRWVDNTPLQLSFWKEGEPNNHGDEDCVELYSDGWNDNRCSTEN
FWICKKPSSPCPGL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggcggagatgtgtgaccccaaggagccggatgaccccgaggtggaggtgtttggggac
cagagactggctaagaaatacaccggcctgctcaggagctcacggagcctgccagggtgt
ctgacccaggcccacctgcctctgctgctgcttcttgtctccctgggcttcttcatgctc
ctggtgaccactctggttcaagtctccaggatccaccaatccctgcagagagacacaggg
gaccatcgggagaggaaccatcaggagagccccggcctcggggatgtttctcaggcccag
aaacaatcatccctggaggagatactccagcagctgacctggatgaatgccaccctggct
ggcctgtgccgccactgcccctggaaatgggaacttttccagggaagctgctacttcttc
tccctgacccagaacacctggaaagagtccatcgccgcgtgtcagaacatgagggcccag
ctggtggtcatcaacagcactgaggagcagaaatttctgaagtcttggaatacgaaaaat
agccagcgcacatggatcggcctcagtgaccaccacaatgagggttcttggagatgggtg
gacaacactcccctccaactcagcttctggaaagaaggggaacccaacaaccacggggat
gaggactgtgtggaattgtacagtgacggctggaatgacaacagatgtagtacagaaaac
ttctggatctgtaagaagccctcgtccccctgcccgggcctctga

DBGET integrated database retrieval system