KEGG   Felis catus (domestic cat): 101082744
Entry
101082744         CDS       T02385                                 
Symbol
EIF2AK2
Name
(RefSeq) interferon-induced, double-stranded RNA-activated protein kinase isoform X1
  KO
K16195  eukaryotic translation initiation factor 2-alpha kinase 2 [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04141  Protein processing in endoplasmic reticulum
fca04217  Necroptosis
fca05010  Alzheimer disease
fca05160  Hepatitis C
fca05162  Measles
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05171  Coronavirus disease - COVID-19
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101082744 (EIF2AK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101082744 (EIF2AK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101082744 (EIF2AK2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101082744 (EIF2AK2)
   05171 Coronavirus disease - COVID-19
    101082744 (EIF2AK2)
   05164 Influenza A
    101082744 (EIF2AK2)
   05162 Measles
    101082744 (EIF2AK2)
   05168 Herpes simplex virus 1 infection
    101082744 (EIF2AK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101082744 (EIF2AK2)
   05169 Epstein-Barr virus infection
    101082744 (EIF2AK2)
   05165 Human papillomavirus infection
    101082744 (EIF2AK2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101082744 (EIF2AK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101082744 (EIF2AK2)
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101082744 (EIF2AK2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fca03019]
    101082744 (EIF2AK2)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101082744 (EIF2AK2)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   101082744 (EIF2AK2)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101082744 (EIF2AK2)
Messenger RNA biogenesis [BR:fca03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     101082744 (EIF2AK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr dsrm ABC1 DND1_DSRM APH Pkinase_fungal Kinase-like Kdo
Other DBs
NCBI-GeneID: 101082744
NCBI-ProteinID: XP_019683233
LinkDB
Position
A3:112816362..112849483
AA seq 542 aa
MANHRPPSFFIEELNVYCQKHNMVLKYQELSKTGPPHNLRFKYQVIIDEREYPEAEGKSK
KEARNAAAKLAIEILNKENKAVSSVSLPTTHSSEGLGLGSTGNFIGRINRLAQKEQLSVN
YEQCELKEPGPERFHYRCKIGQKEYGIGVGSTKQEAKQSAAKLAYEQILSEKTSMKADSV
LAGSLITSPGDSGSNTLVKSISAPESPSENDFLENSSGGSCDRGRVNNSSSPMDNVRNSE
KKVKRSLAPTFNSPVTKDSRCSVELRFTSDFTEIEPIGSGGYGQVFKAKHRIDRKTYVVK
RVKYDSDRKAEREVKALAALNHPNIVHYYSCWFGDDYHSVDSINTSRPKTKCLFIQMEFC
GKGTLEQWIDSRRGQTPDKHLALELYEQITAGVDYIHCKQLIHRDLKPGNVFLVDTKQVK
IGDFGLVTSLKNYANRTRNTGTLRYMSPEQISLQEYGNEVDIFALGLILAELLYICPTVS
ETLQIFKELRDGKFSDVFDGREKILLQKLLSPEPTKRPHASEILETLKEWRNVKENKKRS
TC
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggccaatcatcgtccaccaagtttttttatagaagaacttaatgtatactgtcagaag
cacaacatggtacttaagtatcaggaactgtctaagacgggacctccacataacttaagg
tttaaataccaagttatcatagatgagagagaatatccagaagctgaaggtaaatcgaag
aaggaggccagaaatgctgcagccaaattggcgattgaaatacttaataaagaaaacaag
gcagttagttctgtatcactgccaacaacacattcatcagaaggattaggattaggatcc
actgggaatttcataggccgtatcaataggcttgcccagaaggaacaactgtctgtaaat
tatgaacaatgtgaattgaaagaacctgggcctgaaagatttcattatagatgcaaaatt
ggacagaaagaatacggtattggtgtaggtagtactaagcaagaagccaaacagtcagct
gctaagcttgcgtatgagcagatactttcagagaaaacctcaatgaaagctgactcggtc
ttagctggttctttgattacttcgcctggtgactctggaagcaacactttggtgaaaagc
atatctgctcctgaatcaccatctgaaaatgatttcttggaaaattcatcaggaggaagt
tgtgacaggggccgtgtaaacaattcttcatctcctatggacaatgtcagaaatagtgaa
aagaaggtgaaaagaagtttggcacctacatttaactctcctgtgacaaaagacagcagg
tgttctgtggaactcaggtttaccagtgattttacagaaatagaaccgattggttcaggt
ggatatggccaagttttcaaagcaaaacacagaattgataggaagacttacgttgttaaa
cgtgttaaatatgatagcgacaggaaggcagagcgtgaagtaaaagctttggcagctctc
aatcacccaaatatcgttcactactacagctgctggtttggcgatgattaccattctgtg
gacagcattaacacttcaagaccaaagactaagtgccttttcatccaaatggaattctgt
ggtaaagggacattggagcaatggattgacagcagaagaggccagacaccagacaaacat
ttggctttggaattgtatgaacaaataacagcaggtgtggattatatacattgcaaacag
ttaatccatagagaccttaagccaggtaacgtgtttttggtagatacaaaacaagtaaag
ataggagactttggacttgtgacatccctgaaaaattacgcaaatcggacaaggaataca
ggaactcttcgatacatgagcccagaacagatttctttacaagaatatggaaacgaagtg
gacatctttgctttggggctaattctcgcggaactcctttacatatgtcccactgtttca
gaaacattacagatttttaaagagctaagggacggcaagttctcagatgtatttgatggc
agagaaaaaattcttctgcaaaaattactgtcacccgaacccacgaaacggcctcatgca
tctgaaatactggagactttgaaggagtggaggaatgtaaaagagaataagaaacgaagc
acatgttag

DBGET integrated database retrieval system