KEGG   Felis catus (domestic cat): 101083283
Entry
101083283         CDS       T02385                                 
Symbol
CTSS
Name
(RefSeq) cathepsin S isoform X1
  KO
K01368  cathepsin S [EC:3.4.22.27]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04142  Lysosome
fca04145  Phagosome
fca04210  Apoptosis
fca04612  Antigen processing and presentation
fca05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101083283 (CTSS)
   04142 Lysosome
    101083283 (CTSS)
  09143 Cell growth and death
   04210 Apoptosis
    101083283 (CTSS)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    101083283 (CTSS)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101083283 (CTSS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    101083283 (CTSS)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:fca03110]
    101083283 (CTSS)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.27  cathepsin S
     101083283 (CTSS)
Peptidases and inhibitors [BR:fca01002]
 Cysteine peptidases
  Family C1: papain family
   101083283 (CTSS)
Chaperones and folding catalysts [BR:fca03110]
 Intramolecular chaperones
  Papain family
   101083283 (CTSS)
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Other DBs
NCBI-GeneID: 101083283
NCBI-ProteinID: XP_011283428
Ensembl: ENSFCAG00000003642
UniProt: A0A337RZ12
LinkDB
Position
C1:complement(105896368..105923943)
AA seq 343 aa
MLSMGAPAGSIIMKCLVWVLLVCAYALAQAHKDPTLDHHWNLWKKTYGKQYKEKNEEVAR
RLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVISLMGCLRVPSQWQRNVTYK
SNSNQKLPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGNLVSLSAQNLV
DCSTEKYGNKGCNGGFMTEAFQYIIDNNGIDSEASYPYKAMDGKCQYDSKNRAATCSKYT
ELPFGSEEDLKETVANKGPVSVAIDASHSSFFLYRSGVYYEPACTQTVNHGVLVVGYGNL
NGKDYWLVKNSWGLNFGDRGYIRMARNSGNHCGIASYPSYPEI
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgcttagtatgggagctcctgccggttctatcatcatgaaatgtctggtttgggtgctc
ctggtgtgcgcctatgcattggcacaagcacataaagatcccactctggatcatcactgg
aatctctggaagaaaacgtatggcaaacagtacaaggaaaagaatgaggaggtggcacgg
cgtcttatctgggaaaagaatctaaaatttgtgatgcttcacaatctggaacattcaatg
ggaatgcattcttatgatctaggcatgaaccatctgggagacatgaccagtgaagaagtg
atatctttgatgggttgcctgagagttcccagccaatggcagagaaatgtcacttacaag
tcaaattctaatcagaaattgcctgattctgtggactggagagagaaggggtgtgttact
gaagtgaaataccagggctcttgtggtgcctgttgggctttcagcgctgtcggggctctg
gaggcacagctgaagctgaaaacaggcaatctggtatctctgagtgcacagaacctggta
gattgctcgactgaaaaatacgggaataaaggctgcaacggtggcttcatgacagaggct
ttccagtacattattgataacaacggcatcgattcagaagcttcctatccctacaaagcc
atggatggcaagtgccagtatgactcaaaaaatcgagctgccacatgttcaaagtacaca
gaactcccttttggcagtgaagaggacttgaaagaaaccgtggccaataaaggacccgtg
tccgttgctatagatgcgagccactcttctttcttcctctatagaagtggtgtctactat
gagccagcctgtactcagaccgtgaatcatggtgtattagtggttggctatggtaacctt
aatggaaaagactactggcttgtgaaaaacagctggggcctgaatttcggtgaccgagga
tatattcggatggcaagaaatagtggaaatcattgtgggattgctagttatccctcttac
ccagaaatctag

DBGET integrated database retrieval system