Felis catus (domestic cat): 101083452 Help Entry 101083452         CDS       T02385                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism fca  Felis catus (domestic cat) Pathway fca00510   N-Glycan biosynthesis fca00513   Various types of N-glycan biosynthesis fca04141   Protein processing in endoplasmic reticulum Module fca_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:fca00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     101083452 (TMEM258)    00513 Various types of N-glycan biosynthesis     101083452 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101083452 (TMEM258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  101083452 NCBI-ProteinID:  XP_006937455 UniProt:  M3WJA9 LinkDB All DBs Position D1:complement(105592263..105595481) Genome browser AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctcgaggccatgagcagatacaccagcccagtgaacccagctgtcttcccccat ctgaccgtggtgctgttggccattggcatgttctttaccgcctggttcttcgtctatgag gtgacctccaccaagtacactcgggatatctacaaagagctcctcatctccttggtggcc tcgcttttcatgggctttggagttctcttcctgctgctctgggtcggcatctacgtgtga

DBGET integrated database retrieval system