KEGG   Felis catus (domestic cat): 101083892
Entry
101083892         CDS       T02385                                 
Symbol
ARHGEF1
Name
(RefSeq) rho guanine nucleotide exchange factor 1 isoform X1
  KO
K12330  Rho guanine nucleotide exchange factor 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04270  Vascular smooth muscle contraction
fca04611  Platelet activation
fca04810  Regulation of actin cytoskeleton
fca04928  Parathyroid hormone synthesis, secretion and action
fca05135  Yersinia infection
fca05163  Human cytomegalovirus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101083892 (ARHGEF1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101083892 (ARHGEF1)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    101083892 (ARHGEF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101083892 (ARHGEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101083892 (ARHGEF1)
   05205 Proteoglycans in cancer
    101083892 (ARHGEF1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101083892 (ARHGEF1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101083892 (ARHGEF1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101083892 (ARHGEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101083892 (ARHGEF1)
Membrane trafficking [BR:fca04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    101083892 (ARHGEF1)
SSDB
Motif
Pfam: RGS-like PH_16 RhoGEF PH_13 AbiJ_NTD3
Other DBs
NCBI-GeneID: 101083892
NCBI-ProteinID: XP_023100685
Ensembl: ENSFCAG00000008128
LinkDB
Position
E2:13030540..13048812
AA seq 985 aa
MPSTLPVEPMEADDIARGLAPGPPRPGLVPVSIIGAEDEDFENELETNAEEQNSQFQSLE
QVKRRPAHLMAFLQHVALQFEPGPLLCCLHADMLGSLGPKEARKAFLDFCHSFLEKTAVL
RVPVPPTVAFELDRTRPDLLSEDLQRQFVQEVVQSQQATVSQLLEDFRSKRLMGMTPWEH
DLTQLEAWVGRDRASFEARERHLAERLLTHLEEMQHTISTDEEKSAAVVNAISLYMRHLG
VRTKSGDKKSGRNFFRKKMIGNRRSDEPTKTKKGLSIFLDAARWNRGEPQAPDFRHLKVE
ADAEKPGLTERKGGLGVPSRDRNTGAAGQDIAGVSLHPLSGDSPDREPGVDAPPELGDPP
PQGPASLEPVVPPENTEEGAETERKWKRLSGRLGRSESLRVSDRRRPSRGSLGAKGRGGG
RSRSDVDMDPSSATAVLGPARRATPEPGDEGDPGRSGLELEPEEPPGWRELVPPGTLHSL
PKSQVKRQEVISELLVTEAAHVRMLRVLHDLFYQPMAEGGFFPLEELQYIFPSLDELIEV
HSQFLDQLMKRRQDSGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSHQSFALEQLKAKQ
RKEPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEELAEREKVER
AAECCREILHHVNQAVRDMEDLLRLKDYQKRLDLSHLRQSSDPMLNEFKNLDITRRKLVH
EGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRL
TSAMTREVATDHKAFYVIFTWDQEAQIYELVAQTVSERKNWCALITETAGSLKVPAPASR
PKPRPSPSSTREPLLSSSDNGNCGGREMPPADGRMERIFSTLLPYCRPGPEGQLAAKALE
KVLSLKQLLFPSEEDSGAGPPREGDGVPGGGPPSPTQTQTQEIQEKLLSLEETIKQLEEV
EEEFCRVRLLLSQLGENPVPQPGCT
NT seq 2958 nt   +upstreamnt  +downstreamnt
atgcctagcacactccctgtggagcccatggaggcagacgacattgcccgcgggctggcc
ccgggaccaccgcggcctggcctggtgccagtcagcatcatcggggctgaagacgaagat
tttgagaatgagctggagacgaatgcagaggagcaaaacagccagttccagagtctggag
caggtgaagcggcggcctgcccacctcatggccttcttgcagcacgtcgccctgcagttt
gagccgggacccctgctctgctgcctgcacgcggacatgctgggttcactgggccctaag
gaggccagaaaggccttcctcgacttctgccacagcttcctggaaaagaccgcggttttg
cgggtgccagtccctcccactgttgcctttgaacttgaccgcacacggcccgacctcctc
tccgaggacctccagcggcagtttgtgcaggaggtggtgcagagccagcaggccaccgtc
agccagctgctggaggacttccgctccaagaggctcatgggcatgacaccctgggagcac
gacctgacccagctggaggcctgggtggggcgggaccgtgccagctttgaggcccgggag
cggcacctggccgagcggctgctgacccacctggaagagatgcaacacaccatctcgact
gatgaggaaaagagtgccgccgtggtcaacgccatcagcctgtacatgcgccaccttggg
gtgcggaccaagagcggggacaagaagtcagggaggaatttcttccgaaaaaagatgata
gggaatcggcggtcagatgagccaaccaagacgaagaaaggcctgagcatcttcctggat
gctgcccgctggaatcggggagagcctcaggccccagatttccgacacctcaaagtcgag
gctgatgctgagaagccaggccttacagaaaggaagggaggcctgggggtgccctcccgg
gaccggaacactggggctgctgggcaggacatcgctggagtttccctgcaccctctgtct
ggggacagccctgaccgggagccaggtgttgatgccccaccagagctgggggacccgccc
ccgcagggcccggccagcctggagcccgtggtgcccccggagaacacggaggagggtgct
gagacagagagaaagtggaagaggctatcggggcgtctggggcgctcggagagcctgcgg
gtgagtgaccgccgccggccttcccggggcagcctcggggctaagggccggggtgggggc
cgctcccggagtgacgtggacatggaccccagctctgccacggccgtgcttggccctgcc
cgacgagccacccctgagcctggagatgaaggggacccaggtcggtctggactagagctg
gaaccagaagagccccctggctggcgggagctcgtccccccaggcaccctgcacagcctg
cccaagagccaggtgaagcggcaggaggttatcagcgagctgctggtgaccgaggcggcc
catgtgcgcatgctccgggtgctgcacgacctcttctaccagcccatggcagaaggaggc
ttcttccccctggaggagctacagtacatcttccccagcctggacgagctcatcgaggtg
cattcccagttcctcgatcaactgatgaagcggaggcaggatagtggctacctcattgag
gagatcggagatgtactgctggcccggtttgatggtgccgaaggctcctggttccagaaa
atctcctcccgcttctgcagccaccagtcatttgccttagagcagctcaaagccaaacag
cgcaaggagcctcggttctgtgcctttgtgcaggaggccgagagccgcccacggtgccgc
cgcctgcagctgaaggacatgatccccacggagatgcagcgcctgaccaagtaccccctg
ctcctgcagagcatcgggcagaatacagaagagctggccgaacgggagaaagtggagcgg
gcggctgagtgctgccgggaaattctgcaccacgtcaaccaagctgtgcgcgacatggag
gacctgctgcggctcaaggattatcagaagcgcctggatttgtcccacctgcggcagagc
agcgaccccatgctgaacgagttcaagaacctagacatcaccaggaggaagctggtccac
gagggcccgctgacgtggcgggtgacgaaggacaaggctgtagaggtccacgtgctcctg
ctggacgacctgctgctactgctccagcgccaggacgagcggctgctgctcaagtcgcac
agccggacgctgacgcccacccccgacggcaagaccatgctgcggcccgtgctgcggctc
acgtccgccatgacccgcgaggtggccaccgatcacaaagccttctatgtcatttttacc
tgggaccaagaggctcagatctacgagctggtggcccagaccgtgtcggaacggaagaac
tggtgtgccctcatcacggagaccgctggatccttgaaggtccctgcccctgcctctcgc
cccaaaccccggcccagcccaagcagcacccgggaacccctgctcagcagctcggacaat
ggcaactgtggtggccgagagatgcccccagctgacggccgcatggagagaatcttcagc
accctcctgccctactgcagacccggccctgaaggccagctggcagccaaggcccttgag
aaagtgctgtccctgaagcaactcctgtttccctcggaggaagatagtggggcggggcct
ccccgtgaaggggatggggtcccggggggcggccccccgagcccgacacagacccagacc
caggaaattcaggagaagctgctcagcctggaggagaccattaaacagctggaggaggtg
gaagaggaattctgtcgtgtacgactcctcctgtctcagcttggggaaaaccctgtcccc
cagcctggctgtacctga

DBGET integrated database retrieval system