KEGG   Felis catus (domestic cat): 101084185
Entry
101084185         CDS       T02385                                 
Symbol
MMP9
Name
(RefSeq) matrix metalloproteinase-9
  KO
K01403  matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04657  IL-17 signaling pathway
fca04668  TNF signaling pathway
fca04670  Leukocyte transendothelial migration
fca04915  Estrogen signaling pathway
fca04926  Relaxin signaling pathway
fca05161  Hepatitis B
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05215  Prostate cancer
fca05219  Bladder cancer
fca05415  Diabetic cardiomyopathy
fca05417  Lipid and atherosclerosis
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101084185 (MMP9)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    101084185 (MMP9)
   04670 Leukocyte transendothelial migration
    101084185 (MMP9)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101084185 (MMP9)
   04926 Relaxin signaling pathway
    101084185 (MMP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101084185 (MMP9)
   05202 Transcriptional misregulation in cancer
    101084185 (MMP9)
   05206 MicroRNAs in cancer
    101084185 (MMP9)
   05205 Proteoglycans in cancer
    101084185 (MMP9)
  09162 Cancer: specific types
   05219 Bladder cancer
    101084185 (MMP9)
   05215 Prostate cancer
    101084185 (MMP9)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101084185 (MMP9)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101084185 (MMP9)
   05418 Fluid shear stress and atherosclerosis
    101084185 (MMP9)
   05415 Diabetic cardiomyopathy
    101084185 (MMP9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101084185 (MMP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    101084185 (MMP9)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     101084185 (MMP9)
Peptidases and inhibitors [BR:fca01002]
 Metallo peptidases
  Family M10
   101084185 (MMP9)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 PT Reprolysin_4 Reprolysin_3 DUF4953 Peptidase_M66 Ntox28
Other DBs
NCBI-GeneID: 101084185
NCBI-ProteinID: XP_003983461
Ensembl: ENSFCAG00000014014
LinkDB
Position
A3:complement(15240356..15247890)
AA seq 705 aa
MSPRQPLVLALLVLGCCTAAPRPRKPTVVVFPGDLRTNLTDRQLAEEYLYRYGYTHVAEI
SDDQQSLSRGLRLLQRRLALPETGELDRTTLEAIRTPRCGVPDLGKFQTFEGDLKWHHHN
ITYWIQNYSEDLPRDVIDDAFARAFAAWSAVTPLTFTRVYGLEADIVIQFGVREHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDEELWSLGKGVVVPTYFGNAGGAACHFPFTFEGRS
YSACTTDGRSDDMLWCSTTADYDTDRRFGFCPSERLYTQDGNGEGKPCVFPFTFEGRSYS
ACTTEGRSDGYRWCATTANYDQDKLYGFCPTRADSTVTGGNSAGELCVFPFIFLGKEYST
CTREGRGDGHLWCATTSNFDRDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYSFTEGPPLHEDDVKGIQHLYGPRPEPEPRPPTTTTPESQPTVCTTGPPTTRPPERPT
AGPTGPPSAGPTGPPTAGPSEAPTVSLDPAEDVCNVNVFDAVAEIGNLLHFFKDGKYWQF
SENPGRRVRGPFLITNKWPALPRKLDSAFEDPLTKKTFFFSGRQVWVYTGTSVLGPRRLD
KLGLGPEVAQITGALPRSGGKVLLFSRQRFWRFDVKTQTVDAKSAGQVEQMFPGVPLNTH
DIFQFQEKAYFCQDRFYWRVSSRNEVNQVDQVGYVTFDLLQCPED
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgagccccaggcagcccctggtcctggcgctcctggtgctgggctgctgcaccgccgct
cccagaccacgcaagcccaccgttgtggtcttcccaggagacttgcgaactaatctcact
gacaggcagctggcagaggaatatctgtatcgctatggctatactcatgtggcggagata
agcgacgaccagcagtccctgagtaggggactgcggcttctccagaggcgcctggctctg
cctgagactggcgaactggacagaaccaccctggaggccatacgaaccccccgctgcggc
gtcccagacctgggcaaattccagacctttgagggcgacctcaagtggcatcaccacaac
atcacgtactggatccagaactactcggaagacttgccgcgcgacgtgatcgacgacgcc
tttgcccgcgccttcgcggcctggagcgcagtgacgccgctcaccttcacgcgcgtgtat
ggcctcgaggcagacatcgtcatccagtttggtgtcagggagcacggagatgggtacccc
ttcgatgggaaagacgggctcctggcacacgcctttcctcccggcccaggcattcaggga
gacgcccacttcgacgatgaggaattgtggtctctgggcaagggcgtagtggttcccacc
tacttcggaaacgcaggtggcgccgcctgccacttccctttcaccttcgagggccgctcc
tactcggcctgcaccacggacggccgctccgacgacatgctctggtgcagcaccaccgcc
gactacgacaccgaccgccggttcggcttctgccccagcgagagactctacacccaggac
ggcaatggagaaggcaagccctgcgtgtttccgttcaccttcgagggccgctcctactcc
gcctgcaccaccgagggtcgctcagacggctaccgctggtgcgccactacggccaactac
gaccaggacaagctctatgggttctgcccaacccgagctgactctacagtgaccggtggc
aactccgctggggagctgtgtgtctttcccttcatcttcctgggcaaggagtactcaaca
tgcaccagggagggccgcggagatgggcacctctggtgcgccaccacctcgaacttcgac
agagacaagaagtggggcttctgcccggaccaaggatacagcttgttccttgtggcagcc
catgaattcggccatgctctgggtttagatcactcatcggtgccagaggcactcatgtac
cccatgtacagcttcacggagggcccccccctgcatgaggacgacgtgaaaggcatccag
catctgtacggtcctcgccctgaacctgaaccacggcctccaaccaccaccacacctgaa
tcccagcccaccgtctgcactacggggcctcccaccacccgccccccagagcgccccact
gctggccccacaggccccccttcagctggccccacgggtccccccactgctggcccttct
gaggcccctacagtgtctttggatccagcagaagatgtgtgcaacgtgaacgttttcgac
gctgttgcggagatcgggaatcttctgcatttcttcaaggatgggaagtactggcagttc
tctgagaacccaggacgccgggtgcggggccccttccttatcaccaacaagtggcctgcg
ttgccccgcaagctggactccgcctttgaggacccgctgaccaagaagactttcttcttc
tctgggcgccaggtgtgggtgtacacaggaacgtcggtgcttggcccgaggcgtctggac
aagctgggcctgggcccggaggtggcccaaatcactggggccctcccgcgcagcgggggt
aaggtgctgctcttcagcaggcagcgcttctggaggttcgacgtgaagacgcagaccgtg
gatgccaagagcgccggccaggtggagcagatgttccccggcgtgcccttgaacacgcac
gacatctttcagttccaagagaaagcttacttctgccaggaccgcttctattggcgtgtg
agttctcggaatgaggtgaaccaggtggaccaagtgggctacgtgacctttgacctcctg
cagtgccccgaggattag

DBGET integrated database retrieval system