KEGG   Felis catus (domestic cat): 101084320
Entry
101084320         CDS       T02385                                 
Symbol
DOCK1
Name
(RefSeq) dedicator of cytokinesis protein 1 isoform X1
  KO
K13708  dedicator of cytokinesis protein 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04510  Focal adhesion
fca04666  Fc gamma R-mediated phagocytosis
fca04810  Regulation of actin cytoskeleton
fca05100  Bacterial invasion of epithelial cells
fca05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101084320 (DOCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101084320 (DOCK1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101084320 (DOCK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101084320 (DOCK1)
   05100 Bacterial invasion of epithelial cells
    101084320 (DOCK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101084320 (DOCK1)
Membrane trafficking [BR:fca04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    101084320 (DOCK1)
SSDB
Motif
Pfam: DOCK_N DOCK-C2 DHR-2_Lobe_A DHR-2_Lobe_C DHR-2_Lobe_B SH3_1 SH3_9 SH3_2
Other DBs
NCBI-GeneID: 101084320
NCBI-ProteinID: XP_011285922
Ensembl: ENSFCAG00000008372
UniProt: M3W9G8
LinkDB
Position
D2:84463735..84997986
AA seq 1889 aa
MTRWVPTKREEKYGVAFYNYDARGADELSLQIGDTVHILETYEGWYRGYTLRKKSKKGIF
PASYIHLKEAIVEGKGQHETVIPGDLPLIQEVTTTLREWSTIWRQLYVQDNREMFRSVRH
MIYDLIEWRSQILSGTLPQDELKELKKKVTAKIDYGNRILDLDLVVRDEDGNILDPELTS
TISLFRAHEIASKQVEERLQEEKSQKQNIDINRQAKFASTPSLALFVNLKNVVCKIGEDA
EVLMSLYDPVESKFISENYLVRWSSSGLPKDIDRLHNLRAVFTDLGSKDLKRDKISFVCQ
IVRVGRMELRDNNTRKLTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIPFQPLALDDAI
RHKPLNMSSRFSPRVAGENDFLQTVINKVIAAKEVNHKGQGLWVTLKLLPGDIHQIRKEF
PHLVDRTTAVARKTGFPEIIMPGDVRNDIYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDG
KRLEHVIFPGAGDEGISEYKSVIYYQVKQPRWFETVKVAIPIEDVNRSHLRFTFRHRSSQ
DSKDKSEKIFALAFVKLMRYDGTTLRDGEHDLIVYKAEAKKLEDAATYLSLPSTKAELEE
KAHSATGRSMQSLGSCTISKDSFQISTLVCSTKLTQNVDLLGLLKWRSNTSLLQQNLRQL
MKVDGGEVVKFLQDTLDALFNIMMENSESETFDTLVFDALVFIIGLIADRKFQHFNPVLE
TYIKKHFSATLAYTKLTKVLRNYVDNAEKPGINDQLYKAMKALEYIFKFIVRSRILFNQL
YEDKGEADFMESLLQLFRSISDMMRGESDQTVRVKGAALKYLPTIVNDVKLVFDPKELSK
MFTDFILNVPMGLLTIQKLYCLIEIIHSDLFTQHDCREILLPMMTDQLKYHLERQEDLEA
CCHLLSNILEVLYRKDVGPTQRHVQIIMEKLLRTVNRTVISMGRDSELTGNFVACMTAIL
RQMENYHYAHLIKTFGKMRTDVVDFLMETFIMFKNLIGKNVYPFDWVIMNMMQNKVFLRA
INQYADMLNKKFLDQANFELQLWNNYFHLAVAFLTQESLQLENFSSAKRAKILNKYGDMR
RQIGFEIRDMWYNLGQHKIKFIPEMVGPILEMTLIPETELRKATIPIFFDMMQCEFHSTR
SFQMFENEIITKLDHEVEGGRGDEQYKVLFDKILLEHCRKHKYLAKTGETFVKLVVRLME
RLLDYRTIMHDENKENRMSCTVNVLNFYKEIEREEMYIRYLYKLCDLHKECDNYTEAAYT
LLLHAKLLKWSEDVCAAHLTQRDGYQATTQGQLKEQLYQEIIHYFDKGKMWEEAIALGKE
LAEQYENEMFDYEQLSELLKKQAQFYENIVKVIRPKPDYFAVGYYGQGFPTFLRGKVFIY
RGKEYERREDFEARLLTQFPNAEKMKTTSPPGDDIKNSPGQYIQCFTVKPKLDLPPKFHR
PVSEQIVSFYRVNEVQRFEYSRPIRKGEKNPDNEFANMWIERTIYTTAYKLPGILRWFEV
KSVFMVEISPLENAIETMQLTNDKMNSMVQQHLHDPSLPINPLSMLLNGIVDPAVMGGFA
NYEKAFFTERYLQEHPEAHEKIEKLKDLIAWQIPFLAEGIRIHGDKVTEALRPFHERMEA
CFKQLKEKVEKQYGVRTMPSSLDDRRGSRPRSMVRSFTMPSSSRPLSVASVSSLSSDSTP
SRPGSDGFSLEPLLPKKMHSRSQDKLDKDDPDKEKKDKKKEKRNSKHQELFDKEFKPTDV
SLQQSEAVILSETISPLRPQRPKSQVINVTGSERRFSVSPSPPSSQPTPPPVTPRAKLSF
SLQSSLELNGMTGLTGMDTAEVPPPLPLKGSMADYGNLMENQDLISSPTPPPPPPHQRHA
PPPLPSKTPPPPPPKTTRKQTSVDSGIVQ
NT seq 5670 nt   +upstreamnt  +downstreamnt
atgacgcgctgggtgcccaccaagagagaggagaaatacggcgtggctttttataactac
gatgccaggggagcggatgaactttctctacaaataggagacactgtgcacatcttagaa
acatatgaagggtggtacagaggttacaccttgagaaaaaagtctaagaagggtatattt
cctgcttcgtatattcatcttaaagaagccatagttgaaggcaaagggcaacatgaaacg
gtcatcccgggcgacctcccgctcatacaggaagtcaccacgacgctccgagagtggtcc
accatctggaggcagctctacgtgcaagacaacagggagatgtttcgaagcgtgcggcac
atgatctatgaccttatcgaatggcgatcgcagattctttctggaactctgccacaggat
gagctcaaagaactgaagaagaaggtcactgccaaaatcgattatggaaacagaattctt
gatctggacttggtggtgagagatgaagatgggaacattttggatccagaactaactagc
acgattagtctctttagagctcatgaaatcgcttctaaacaagtggaggaaagattgcaa
gaagaaaagtcccaaaagcagaacatagatattaacagacaagctaagtttgcctccacc
ccttctctggccttgtttgtcaacctcaaaaatgtggtttgtaaaattggagaagatgct
gaagtgctgatgtctctttatgaccctgtggagtccaaattcatcagtgaaaactacctg
gttcgctggtcaagttcaggattgcctaaagacatagacagattacataatttgcgagct
gtttttactgacctcggaagcaaagacctgaaaagggacaaaatcagtttcgtttgtcag
atcgtacgagtgggtcgcatggagctgagggacaacaataccaggaaactgacctcgggc
ctgcggcggcctttcggcgtggctgtgatggatgtaacagatataataaatggaaaagta
gatgatgaagataagcagcatttcatcccctttcagccgctcgcgttggacgacgccatt
cgacacaagccgctgaacatgtcatcccgtttttcacccagggtggcaggggagaatgac
ttccttcagactgttataaacaaagtcattgctgccaaagaagtcaaccacaagggccag
ggtttgtgggtaacattgaaattacttcctggagatatccatcagattagaaaagaattt
cctcatttagtggacaggaccacagcagtggctcggaagacggggtttccggagataatc
atgcctggtgacgttcgaaatgatatctacgtaactttagttcaaggcgattttgataaa
ggaagcaagacgacagcgaagaatgtggaggttaccgtgtctgtttatgacgaggacgga
aaacggttggagcatgtgattttcccgggtgccggcgacgaagggatttcagagtacaag
tctgtgatttactaccaagtcaagcagccgcgttggtttgagaccgttaaggtggccatt
cccattgaggacgtcaaccgcagtcaccttcggtttaccttccgccacagatcgtcacag
gactccaaggataaatctgagaaaatatttgcactagcatttgtaaagctgatgagatac
gatgggaccactctgagggacggggagcatgatctcatcgtctacaaggcggaggcaaag
aagctggaggacgccgcgacctacctaagcctgccctccacgaaggcggagctggaagaa
aaggcgcactctgccacgggcaggagcatgcagagtcttggaagctgcaccatcagcaaa
gattccttccagatctcaacactggtgtgttccacgaagcttacccagaacgtggacctg
ctggggctgctcaagtggcgctccaacaccagcttgctgcagcagaacttgaggcagctg
atgaaggtcgatggtggcgaagtggtgaagttcctccaggacaccttggatgccctcttc
aacatcatgatggagaactccgagagcgagaccttcgatacgttagtgtttgacgctctg
gtatttatcattggactaattgctgatagaaaatttcaacattttaatcctgttctggaa
acctacattaagaaacactttagtgcaacattagcctacacgaagctgacaaaagtttta
agaaactatgtggacaatgcggaaaagccgggaataaatgaccagctgtacaaagctatg
aaggctttggagtacatcttcaagttcatcgtgcgctccaggatcctgttcaatcaactg
tacgaagacaaaggagaggccgacttcatggagtccctgctacagctcttccgatccatc
agcgacatgatgaggggcgagtcggaccagaccgtccgggtgaagggggcagcgttgaaa
tacttgccaaccattgtcaacgatgtgaaattggtgttcgatcccaaagagctcagcaaa
atgtttactgatttcatcctaaatgttcccatgggtttgctgaccattcagaagctgtac
tgcttgattgaaatcattcacagtgacctcttcacacagcatgactgcagagagatcctg
cttcccatgatgacggatcagctcaagtaccatctggagagacaagaagacctggaggcc
tgctgccacctgctcagcaacattttggaggttctgtacaggaaggatgtggggccaact
cagaggcatgtccagataatcatggagaagcttctgcggacagtgaaccgaactgtcatt
tccatggggcgggattccgagctcactggaaacttcgtggcttgtatgacagctatttta
cgacagatggaaaattatcattacgcccatttgatcaagacttttggaaaaatgaggact
gatgttgttgatttcctgatggaaacattcatcatgtttaagaacctcattgggaagaac
gtctaccctttcgactgggtgataatgaacatgatgcagaataaagtcttcctgcgagcg
attaatcagtatgcagatatgctgaacaaaaaatttctggatcaagccaactttgagcta
cagctttggaacaactactttcacctggctgtcgctttcctcactcaagagtccttgcaa
ctggagaatttttcgagcgcgaagagagccaaaatccttaacaagtacggagacatgagg
aggcagatcggcttcgaaatcagagacatgtggtacaaccttggtcaacacaagataaag
ttcattccagaaatggtcggcccgatactagaaatgacactaattcctgagacagaactg
cgcaaagccaccatacccattttctttgatatgatgcagtgtgagttccattcgacccgc
agcttccagatgtttgaaaatgagatcatcaccaagctggatcatgaagtggaaggaggc
agaggagatgaacagtacaaagtgttatttgataaaatcctcttggaacactgcaggaaa
cacaaatacctcgccaaaacaggagaaacttttgtaaaactcgttgtgcgcctgatggaa
agactcctggattatagaaccatcatgcatgatgagaacaaagaaaatcgtatgagctgc
actgtcaacgtgctgaatttctacaaagaaattgaaagagaagaaatgtatataaggtat
ttgtacaagctgtgtgacctgcataaagagtgtgataactacacggaggcagcttatacc
ttgcttctccatgcaaagcttctgaagtggtcagaggacgtgtgtgcggcccacctcacc
cagcgggacgggtaccaggcgacaacacagggacagctgaaagaacagctctatcaggag
atcatccactacttcgacaaaggcaagatgtgggaggaggccattgctctgggtaaggaa
cttgctgaacagtatgaaaacgagatgtttgattacgaacaactcagcgaattgctgaaa
aaacaggctcagttttatgaaaacatcgtcaaagtgataagacctaagcctgactatttc
gctgttggctactacggacaaggattccccacgttccttcgggggaaagttttcatttac
cgagggaaggagtacgaacgcagggaagattttgaagctcgcctcttaactcagttcccc
aacgcagagaaaatgaagacgacatctcccccaggcgacgacatcaaaaactcgcctggc
caatacattcagtgcttcaccgtaaagcccaaacttgacctgcccccgaaatttcaccgg
cctgtgtcagagcagatcgtaagtttttacagggtgaacgaggtccagcgatttgaatat
tctcggccgatccgcaagggagagaaaaacccagacaatgaatttgcgaacatgtggatc
gagaggaccatatacacaacagcgtacaaattacctgggattctaaggtggtttgaagtc
aaatctgttttcatggtggagatcagccccctggagaacgccatcgagaccatgcagctg
accaacgacaagatgaacagcatggttcagcagcacctgcacgaccccagcctccccatc
aaccccctctccatgctcctcaacggcatcgtggaccctgccgtcatgggaggctttgcg
aattatgaaaaggccttcttcacagagcggtacctgcaggaacatccagaggcccatgag
aagattgagaagctcaaagacctgattgcatggcagattccatttttggctgaagggatc
aggattcatggagacaaagtcacagaagcactgaggccatttcacgagagaatggaagcc
tgtttcaaacagctgaaagaaaaagtggaaaagcaatatggcgtccgaaccatgccctca
agtctggatgacagaagaggcagccgtccccggtccatggtccgatccttcacgatgcct
tcttcgtcccggcctctgtcggtagcttccgtgtcttccctgtcctcagacagcacccct
tccagaccaggctccgatgggttttccctggagcctctcctgccaaagaaaatgcactcc
aggtcccaggacaagctggacaaggacgacccagataaggagaagaaggacaagaagaag
gaaaaaaggaatagcaaacatcaagagctatttgataaagaatttaaacccaccgacgtc
tccctgcagcagtctgaggctgtgatcctttccgagacgataagtcccctgcggccccag
cgaccgaagagccaggtgatcaacgtcaccggaagtgaaagacgtttctcggtgtccccg
tcaccaccatcctcccagccgacaccccctccggtcacgccaagggccaagctcagcttc
agtttgcagtcaagtttggagctgaacggcatgaccggcctgactgggatggacacggcc
gaggtcccgccccccctgcctctcaagggcagcatggcagattatgggaacttgatggaa
aaccaggatctgatcagctcgccgacgcccccgccccctcctcctcaccagaggcacgca
ccgcctccgctgcccagcaagacgccacccccgccccccccaaagaccacgcgcaagcag
acatccgtggactctggcatcgtgcagtga

DBGET integrated database retrieval system