KEGG   Felis catus (domestic cat): 101085363
Entry
101085363         CDS       T02385                                 

Symbol
CD40
Name
(RefSeq) tumor necrosis factor receptor superfamily member 5 isoform X1
  KO
K03160  tumor necrosis factor receptor superfamily member 5
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04064  NF-kappa B signaling pathway
fca04514  Cell adhesion molecules
fca04620  Toll-like receptor signaling pathway
fca04672  Intestinal immune network for IgA production
fca05144  Malaria
fca05145  Toxoplasmosis
fca05166  Human T-cell leukemia virus 1 infection
fca05169  Epstein-Barr virus infection
fca05202  Transcriptional misregulation in cancer
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05322  Systemic lupus erythematosus
fca05330  Allograft rejection
fca05340  Primary immunodeficiency
fca05416  Viral myocarditis
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101085363 (CD40)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101085363 (CD40)
   04514 Cell adhesion molecules
    101085363 (CD40)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101085363 (CD40)
   04672 Intestinal immune network for IgA production
    101085363 (CD40)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101085363 (CD40)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101085363 (CD40)
   05169 Epstein-Barr virus infection
    101085363 (CD40)
  09174 Infectious disease: parasitic
   05144 Malaria
    101085363 (CD40)
   05145 Toxoplasmosis
    101085363 (CD40)
  09163 Immune disease
   05310 Asthma
    101085363 (CD40)
   05322 Systemic lupus erythematosus
    101085363 (CD40)
   05320 Autoimmune thyroid disease
    101085363 (CD40)
   05330 Allograft rejection
    101085363 (CD40)
   05340 Primary immunodeficiency
    101085363 (CD40)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101085363 (CD40)
   05416 Viral myocarditis
    101085363 (CD40)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101085363 (CD40)
   04090 CD molecules [BR:fca04090]
    101085363 (CD40)
Cytokine receptors [BR:fca04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   101085363 (CD40)
CD molecules [BR:fca04090]
 Proteins
  101085363 (CD40)
SSDB
Motif
Pfam: TNFR_c6 Glycophorin_A RANK_CRD_2
Other DBs
NCBI-GeneID: 101085363
NCBI-ProteinID: XP_003983558
Ensembl: ENSFCAG00000014018
LinkDB
Position
A3
AA seq 279 aa
MVLLPLRCLLWGCVLTAVHPDPHTTCRENQYLINSRCCDKCQPGEKLVNDCTEFTSTECL
PCKKGEFLDTWNIERHCHQHKYCDPNQGLQVQREGTSETDTTCTCDEGLHCTSDACESCI
QHTLCPPGLGVKQVATGVSDTICHPCPAGFFSNVSSASEKCHPWTRCETKGLVELQAGTN
KTDAVCGFQDRIRALVVIPITMVVLLAVLLVSAYIRKVTKKPENKVLQPKAVSQDPVEDL
EVLPVPLHPIAPVQETLHGCQPVTQEDGKESRISVQERV
NT seq 840 nt   +upstreamnt  +downstreamnt
atggttcttctgcctctgcgctgtctcctctggggctgcgtgttgaccgccgtccaccca
gacccacacactacgtgcagagaaaaccagtacctgataaacagtcggtgctgtgataag
tgccagccaggagagaaactggtgaatgactgcacagagttcacctccacggaatgcctt
ccttgcaaaaaaggcgaattcctagacacttggaacatagagagacactgtcaccagcac
aagtactgcgaccccaaccaagggctccaggtccagagggaaggcacctcagaaactgac
accacttgcacatgtgacgaaggtctacactgtaccagcgacgcctgtgaaagctgcatc
cagcacaccctgtgcccccctggccttggagttaagcaggttgctacaggggtttctgat
accatctgccatccgtgcccagccggcttcttctccaatgtgtcatctgcttcggaaaag
tgtcacccttggacgaggtgtgagaccaaaggcctggtggagcttcaggcggggaccaac
aagacggatgccgtctgcggtttccaggatcggataagagccctggtggtgatccccatc
acgatggtggtcctgcttgctgtcttgttggtgtctgcgtatatcagaaaggtgaccaag
aagccagagaataaggtcctccagcctaaggctgtgtcgcaggaccctgtggaggacttg
gaggtccttcctgtccccctccaccccattgctccggtgcaggagaccttacacgggtgc
cagccggtcacccaggaggatggcaaagagagccgcatctcggtgcaggagagagtatga

DBGET integrated database retrieval system