KEGG   Felis catus (domestic cat): 101085396
Entry
101085396         CDS       T02385                                 
Symbol
CXCR2
Name
(RefSeq) C-X-C chemokine receptor type 2
  KO
K05050  C-X-C chemokine receptor type 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04072  Phospholipase D signaling pathway
fca04144  Endocytosis
fca05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    101085396 (CXCR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101085396 (CXCR2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101085396 (CXCR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101085396 (CXCR2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101085396 (CXCR2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101085396 (CXCR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101085396 (CXCR2)
   04050 Cytokine receptors [BR:fca04050]
    101085396 (CXCR2)
   04090 CD molecules [BR:fca04090]
    101085396 (CXCR2)
G protein-coupled receptors [BR:fca04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    101085396 (CXCR2)
Cytokine receptors [BR:fca04050]
 Chemokine receptors
  CXC Chemokine
   101085396 (CXCR2)
CD molecules [BR:fca04090]
 Proteins
  101085396 (CXCR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx TMEM70
Other DBs
NCBI-GeneID: 101085396
NCBI-ProteinID: XP_019694217
Ensembl: ENSFCAG00000023545
LinkDB
Position
C1:203274947..203285053
AA seq 356 aa
MEVDWDDYSLEDFFDMENYSYNTDLPTILSDSAPCRPESLEINQYAMVVIYALVFVLSLL
GNSLVILVVLYSRVSRSVTDVYLLNLAIADLLFALTLPIWAASKAKGWIFGTALCKVVSL
LKEINFYSSILLLACISVDRYLAIVHATRTLTQKRHWVKFICLGIWALSLILSLPIFIFR
RAIYPPYSSPVCYEDMGANTTKWRMVMRVLPQTFGFLLPLMVMLFCYGLTLRTLFEAHMG
QKHRAMRVIFAVVLIFLLCWLPYNLVLIADTLMRLRAIKETCERRNDIGRALDATEILGF
FHSCLNPIIYAFIGQKFRHGLIKIMAIHGLISKEHLSKDSRPSFVGSSSGNTSTTF
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggaagtagactgggatgattacagcttggaagatttcttcgacatggaaaattatagt
tacaacactgacctgcccactattctgtcagactctgccccatgcaggccagaatctctg
gaaatcaatcagtatgccatggtggtcatctatgccctggtcttcgtgctcagcctactg
ggaaactccttagtgatactggttgtcttatatagtcgggtgagtcgttctgtcactgat
gtctacctgctgaatctggccatagccgacttgctctttgccctgaccttgcctatctgg
gctgcctccaaggcaaagggctggatctttggcacagccctttgcaaggtggtctcgctc
ctgaaagaaatcaacttctacagcagcatcctgctgctggcctgcatcagcgtggaccgc
tatttggccattgtccatgccacacgcacactgactcagaagcggcactgggtcaagttc
atatgcttaggcatctgggccctgtccctgatcctgtccctgcccatcttcatcttccgc
agggccatctatcccccctattccagcccagtctgctatgaggacatgggtgccaatact
acaaaatggcggatggtgatgcgggtcctgccccagacctttggcttcctcctgcccttg
atggtcatgctattttgctatggactcaccctgcgcacgctgtttgaggcccacatgggg
cagaaacaccgggccatgagggtcatctttgctgtcgtgctcatcttcctgctctgctgg
ctgccctacaacctggtcctgatcgcagacaccctcatgaggctccgggcgatcaaagag
acctgtgagcgccgcaatgacattggccgggccctggatgccaccgagattctgggcttc
ttccacagctgcctcaatcccattatctacgccttcatcggccagaagtttcgccatgga
ctcatcaagatcatggccatccatggcctcatcagcaaggagcacttgtccaaggacagc
aggccttcctttgttggctcttcttcagggaacacttctactaccttctag

DBGET integrated database retrieval system