KEGG   Felis catus (domestic cat): 101085487
Entry
101085487         CDS       T02385                                 
Symbol
AOX1
Name
(RefSeq) aldehyde oxidase
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00280  Valine, leucine and isoleucine degradation
fca00350  Tyrosine metabolism
fca00380  Tryptophan metabolism
fca00750  Vitamin B6 metabolism
fca00760  Nicotinate and nicotinamide metabolism
fca00830  Retinol metabolism
fca00982  Drug metabolism - cytochrome P450
fca01100  Metabolic pathways
fca04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101085487 (AOX1)
   00350 Tyrosine metabolism
    101085487 (AOX1)
   00380 Tryptophan metabolism
    101085487 (AOX1)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    101085487 (AOX1)
   00760 Nicotinate and nicotinamide metabolism
    101085487 (AOX1)
   00830 Retinol metabolism
    101085487 (AOX1)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    101085487 (AOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101085487 (AOX1)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     101085487 (AOX1)
SSDB
Motif
Pfam: MoCoBD_2 MoCoBD_1 FAD_binding_5 Ald_Xan_dh_C CO_deh_flav_C Fer2_2 Fer2 DHODB_Fe-S_bind
Other DBs
NCBI-GeneID: 101085487
NCBI-ProteinID: NP_001277167
Ensembl: ENSFCAG00000026524
UniProt: M1ZMQ7
LinkDB
Position
C1:187683672..187768783
AA seq 1320 aa
MSCPPKSDDLVFFVNGRKVIERNADPEVTLLNFLRKNLRLTGTKYACGRGGCGACTVMVS
KHDPVSAKIRHFSITACLVPICSLYGAAVTTVEGIGSINTRLHPVQERIARSHGTQCGFC
TPGMVMSMYTLLRNHLQPSEEQLMEALGGNLCRCTGYRPILASGRTFCVESTDCQKKRTG
KCCLDLGGNDSSSLSRESDICTDLFVEEEFQPLDPTQELIFPPELLRMAKNPEKQTLTFH
GERVTWISPGTLKDLLELKAKHPEAPLILGNTSLGPAMKSQGRVHPILLSPARISELSMV
FKTSDGLTIGAGCSLAQVKDILAEQVSELPEEKTQTYRALLKHLKSLAGQQIRNMASLGG
HVISRHCYSDLNPILVVGNATLNVISEEGTRQIPLNDHFLAGLASADLKPEEILESVYIP
HSQKWEFVSAFRQAQCQQNALADVSAGMRVILEEATDTIKELSLSYGGVGESTIGAHKSC
QQLIGRPWNEPMLEEACRLLLEEVSLPGWAPGGRVEFKRTLVVSFFFKFYLEVLQELKKL
DSHHYPEISDRFLSALEDFPVTGPRGVQRYQSVDSHQSLQDPVGRPIMHLSGLKHATGEA
IFCDDIPMVDRELFMVLVTSTKAHAKIISIDLSEALELPGVVDVITAEDIPGTNGAEDDK
LLAVDEVLCVGQIICAVVAETDVQAKRAIEKIKITYKDLEPIIFTINDAIKHNSFLCPEK
KLEQGNIEEAFEKVDQIVEEVHVGGQEHFYMETQRVIVIPKAEDKELDIYVSTQDPAHVQ
KTVSSTLNIPINRITCHVKRVGGGFGGKVGRPAVFGAIAAVGAIKTGRPIRLVLDREDDM
LITGGRHPLFGKYKVGFMNNGRIKALDIECFINGGCTLDDSEQVTEFLILKLENAYKIRN
LRFRGRACMTNLPSNTAFRGFGFPQGTLITESCITAVAAKCGLLPEEIREKNMYKTIDKT
IYKQAFSPETLIRCWNECLDKSSFHSRRIQVEEFNKKNYWKKKGIAIIPMKFSVGFAATS
YHQAAALVHIYTDGSVLVTHGGNELGQGIHTKMLQVASRELKLPMSYMHICETSTATVPN
TIATAASIGSDVNGKAVQNACQILLKRLEPIIKKNPGGTWEDWIEAAFEQRISLSATGYF
RGYKADMDWEKGEGDPFPYYVYGAACSEVEIDCLTGAHKKIRTDIIMDACCSLNPAIDIG
QVEGSFIQGMGLYTTEELKYSPEGVLYSRGPDEYKIPTITDVPEEFNGLGESGMFLGSSV
FFAITDAVAAACKERDIVEDFIVKSPATPEQVRMACADRFTEMIPRDDPQTFKPWSIPIA
NT seq 3963 nt   +upstreamnt  +downstreamnt
atgtcttgcccaccgaaatcagatgacttggttttctttgtgaatgggaggaaggtgata
gagaggaatgcggacccagaagtcactctgctgaactttctacgaaagaacttacgcctc
acaggaaccaagtatgcctgtggaagaggaggctgcggtgcctgtactgtgatggtgtcc
aagcatgacccagtgtctgcaaagataagacacttctccattactgcatgtctggtgccc
atctgctctctgtatggggctgctgtcaccactgtagaaggtattggaagtatcaacacc
aggcttcaccctgtgcaggagaggatcgccaggagccacggcacccagtgcggattctgc
acccctgggatggtgatgtccatgtacacactgcttaggaaccacctacagccttcagag
gagcagctcatggaagccctggggggtaatctatgccgctgtactgggtatcggccaatt
cttgcaagtggaaggaccttctgtgtggagtcaactgactgtcaaaagaaaagaacagga
aaatgctgcttggatctgggaggaaatgattcttcctcactcagcagggaaagtgacatt
tgcacagacttatttgtggaagaggagttccagcccttggaccctacccaggagctcata
tttcccccagaactcttgagaatggcaaagaacccagaaaaacaaaccctgaccttccat
ggagagagggttacctggatctcccctggcaccctcaaggatctcctggagctgaaagca
aaacatcctgaggcccctctcatcttgggcaacacttcactgggacctgcaatgaaatct
caaggacgtgttcacccaattctcctctctcctgctaggatttctgagctcagtatggta
tttaaaacaagtgatggactgacaataggtgctggctgcagtctggcccaagtgaaggac
attttggctgagcaagtttccgagcttccagaggagaaaactcagacataccgagccctc
ctaaagcacctgaagagtctggcaggacagcagatccggaatatggcgtccttaggggga
catgttataagccgacattgctattcggatctgaatccaattttggttgtgggcaatgct
accctcaatgtgatatcagaagaaggtacacggcagatccctctaaatgaccattttctt
gctgggttggcaagtgcagaccttaagccagaggaaattttggaatctgtgtacatcccg
cactctcaaaagtgggaatttgtgtcagccttccgacaggctcagtgccagcaaaatgcc
ttggccgatgtgagtgctggcatgcgagtcattctcgaagaagccacagacaccatcaag
gagctgagcctctcctatggaggggttggggaatccacaattggtgcacataaatcctgc
cagcagctcatagggaggccctggaatgagccaatgctggaggaagcttgcaggctgctt
ctggaagaggtctccctcccaggctgggctccagggggaagagtggaattcaagaggact
ttggtggtcagcttcttcttcaaattctacctagaagttctgcaggaactgaagaaactt
gacagtcatcattatcctgaaatttcagaccgattcctaagtgctctagaagatttcccc
gtcacaggaccccggggagtccaaaggtaccagagtgtggattctcaccagtccctccaa
gatccagttggacgccccatcatgcacctgtcaggtcttaaacatgctacaggtgaagcc
atattttgtgatgacatccctatggtggatagagaacttttcatggttttggtgaccagt
acaaaagcccatgcaaaaatcatatcaattgatttgtctgaggcccttgaactacctggg
gtggttgatgtgataacagctgaggacattccaggcaccaatggtgccgaggatgacaaa
ttgttggctgtagatgaggtgctttgcgtgggccagatcatctgtgctgtggttgcagag
acagatgtacaggcaaagagagcaattgaaaagataaagatcacctacaaagatctggag
cccataatcttcaccatcaatgatgccataaagcacaactcattcctatgccctgaaaaa
aaacttgaacaaggaaacattgaggaggcatttgaaaaagtcgatcaaattgttgaagag
gtccatgttggaggccaggaacatttctacatggaaacacaaagagtgattgttattcca
aaggcagaggacaaagaactggacatttatgtatcaacacaggatccagcccacgtgcag
aaaacagtgtcctctactttaaatatccccatcaacaggatcacctgtcatgtcaagcgg
gtgggtggaggttttggcggaaaagtaggaagaccagctgtatttggggctattgctgct
gtgggtgctatcaaaactggtcgtcccattcgtcttgttcttgatcgtgaagatgatatg
ttaataactgggggaagacacccattatttggaaaatataaagtgggattcatgaacaac
gggcgaatcaaagctctagacattgagtgtttcattaatggaggatgcacactggatgac
tctgagcaggtaacagaatttcttatattaaagctggaaaatgcatataaaatccgcaac
cttagattccggggccgggcatgcatgacaaatttaccatccaatacggcctttcgtgga
tttggcttcccacaaggaaccctgataacagaatcttgcatcacagctgtggcagccaaa
tgtggccttctgccagaagagattagggagaaaaacatgtacaaaacaattgataaaacc
atctacaaacaagcattcagccctgagaccctgataagatgttggaatgagtgtctggac
aagtcttcctttcatagcagaagaatacaagtggaagagtttaacaagaagaattattgg
aaaaagaaaggcattgcaattatccccatgaagttttcagtcggctttgctgcaacaagc
tatcatcaggcagctgcacttgttcatatctacacagatgggtctgtattggtcacacat
ggaggcaacgaactgggacaaggtattcacaccaaaatgctgcaggtggccagccgtgaa
ttaaaactacccatgtcttatatgcacatctgtgaaacaagtacagccacggtaccaaat
acaattgctacagcagcttccattggttcggacgtcaatggcaaagccgtgcagaatgca
tgtcagatccttctgaaacgcctcgagcccatcattaagaaaaatccaggaggtacatgg
gaggactggatagaagctgcttttgaacaaagaatcagtctttcagccactggatacttc
aggggatacaaggccgacatggactgggagaagggagaaggagaccctttcccatactat
gtctatggagcagcctgttctgaggttgaaattgactgcctgacaggcgctcacaagaaa
atcagaacggacatcatcatggatgcatgttgcagcctaaatcccgccattgatattggg
caggttgaaggttcctttattcagggaatgggtctttataccaccgaagagctaaaatat
tccccagaaggtgttctgtactctcgaggcccagatgaatataaaattccaaccatcact
gacgtcccagaagagttcaatggcctgggggagtccgggatgttcttggggtcatctgtg
ttctttgccatcactgatgctgtggccgcagcatgcaaagaaagagacatagtcgaggac
ttcatagtgaagagtccagcaaccccggaacaagttcgaatggcctgtgcagatcggttc
acagagatgatcccaagagatgaccctcagacatttaaaccttggtctatccctatagcg
taa

DBGET integrated database retrieval system