KEGG   Felis catus (domestic cat): 101085500
Entry
101085500         CDS       T02385                                 

Symbol
PTPN11
Name
(RefSeq) tyrosine-protein phosphatase non-receptor type 11 isoform X1
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04014  Ras signaling pathway
fca04072  Phospholipase D signaling pathway
fca04360  Axon guidance
fca04625  C-type lectin receptor signaling pathway
fca04630  JAK-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04670  Leukocyte transendothelial migration
fca04722  Neurotrophin signaling pathway
fca04920  Adipocytokine signaling pathway
fca04931  Insulin resistance
fca05168  Herpes simplex virus 1 infection
fca05205  Proteoglycans in cancer
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05211  Renal cell carcinoma
fca05220  Chronic myeloid leukemia
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101085500 (PTPN11)
   04630 JAK-STAT signaling pathway
    101085500 (PTPN11)
   04072 Phospholipase D signaling pathway
    101085500 (PTPN11)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101085500 (PTPN11)
   04650 Natural killer cell mediated cytotoxicity
    101085500 (PTPN11)
   04670 Leukocyte transendothelial migration
    101085500 (PTPN11)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101085500 (PTPN11)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101085500 (PTPN11)
  09158 Development and regeneration
   04360 Axon guidance
    101085500 (PTPN11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101085500 (PTPN11)
   05208 Chemical carcinogenesis - reactive oxygen species
    101085500 (PTPN11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101085500 (PTPN11)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    101085500 (PTPN11)
   05211 Renal cell carcinoma
    101085500 (PTPN11)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101085500 (PTPN11)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101085500 (PTPN11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101085500 (PTPN11)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     101085500 (PTPN11)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    101085500 (PTPN11)
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 101085500
NCBI-ProteinID: XP_023097204
Ensembl: ENSFCAG00000009695
LinkDB
Position
D3
AA seq 597 aa
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP
VSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEV
ERGKSKCVKYWPDECALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQALLQGNTERTVW
QYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVIDILI
DIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSK
RKGHEYTNIKYSLTDQTSGDQSPLPPCTPTPSCAEMREDNARVYENVGLMQQQKSFR
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgacatcgcggagatggtttcacccaaacatcactggcgtggaggcagaaaacctgctg
ttgacaagaggagttgatggcagttttttggcgaggcccagtaaaagtaaccctggagac
ttcaccctttctgtcagaagaaatggagctgtcacccacatcaagattcagaacaccggt
gattactatgacctgtacggaggggagaagtttgccactctggctgagctggtccagtat
tacatggaacaccacgggcaattaaaagagaagaatggagatgttattgagctcaaatat
cctttgaactgtgcagaccctacctctgaaaggtggtttcatggacacctctctgggaaa
gaagcagagaaattattaacggagaaaggaaaacacggcagctttctggtacgagagagc
cagagccatcctggagattttgttctctctgtccgaactggtgatgacaaaggggaaagc
aacgatggcaagtctaaagtgacccacgttatgatccgctgtcaggaactgaaatatgat
gttggtggaggagaacggtttgactctttgacagatctcgtggagcattacaagaagaac
cccatggtggaaacattgggcacagtgctacaactcaagcagcccctcaacacaacacgc
atcaatgctgctgaaatagaaagccgggttcgagaactaagcaaattagctgagaccaca
gataaagtcaaacaaggcttttgggaagaatttgagacactacagcaacaggagtgcaaa
cttctctacagcagaaaagagggtcagagacaagaaaataagaacaaaaatagatacaaa
aacatcctacccttcgatcataccagagttgtcctccatgatggtgatcccaatgagcct
gtttcagattacatcaatgcaaatattatcatgcctgagtttgaaaccaaatgcaacaat
tcaaagcccaaaaagagttacattgccacacaaggctgcctgcaaaacacggtgaatgac
ttctggcggatggtgtttcaagaaaactcgcgagtgattgtcatgacgacgaaagaagtg
gagagaggaaagagtaaatgtgtcaaatactggcctgacgagtgtgctctaaaagaatat
ggggtcatgcgtgttaggaacgtcaaagaaagcgccgctcatgactatacgttaagagaa
cttaaactttcgaaggttggacaagctctactccaggggaatacagagagaaccgtgtgg
caataccactttcggacctggccggaccacggagtgcccagtgaccccgggggcgtgctg
gacttcctggaggaggtccaccataagcaagagagcattatggacgcggggcctgtggta
gttcactgcagtgctggaattggccggacagggacgttcattgtgattgatatccttatt
gacatcatcagagagaaaggtgtcgactgcgacatcgatgttcccaagaccattcagatg
gtgcggtctcagaggtcagggatggtccagacggaagctcagtaccgcttcatctacatg
gccgttcagcattacattgaaacactacagcgcaggattgaagaagagcagaaaagcaag
aggaaagggcacgaatatacaaatattaagtattctctcacggaccagacaagtggagat
cagagtcccctcccgccttgtactccaacaccatcctgcgcagaaatgagagaagataat
gccagagtctatgaaaacgtaggtctgatgcagcagcagaaaagtttcagatga

DBGET integrated database retrieval system