KEGG   Felis catus (domestic cat): 101085709
Entry
101085709         CDS       T02385                                 
Symbol
MAVS
Name
(RefSeq) mitochondrial antiviral-signaling protein isoform X2
  KO
K12648  mitochondrial antiviral-signaling protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05164  Influenza A
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101085709 (MAVS)
   04622 RIG-I-like receptor signaling pathway
    101085709 (MAVS)
   04623 Cytosolic DNA-sensing pathway
    101085709 (MAVS)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    101085709 (MAVS)
   05160 Hepatitis C
    101085709 (MAVS)
   05171 Coronavirus disease - COVID-19
    101085709 (MAVS)
   05164 Influenza A
    101085709 (MAVS)
   05162 Measles
    101085709 (MAVS)
   05168 Herpes simplex virus 1 infection
    101085709 (MAVS)
   05169 Epstein-Barr virus infection
    101085709 (MAVS)
SSDB
Motif
Pfam: CARD_2
Other DBs
NCBI-GeneID: 101085709
NCBI-ProteinID: XP_003983730
Ensembl: ENSFCAG00000022983
LinkDB
Position
A3:30742483..30754129
AA seq 523 aa
MTFAEDKTYDYIRHHYSNFGHIHVLEILPYLSCLTISDQDRLRAYYQLWGNQGTLWELFN
SLRRRTGWVESFIKALRICELAGLADEVASVYQSNLPGVPKNCPPAPLEPQLAPAEVPGP
STPAVAPSAPHNGYREEESSFPMPVQDTEPPGSLGESSKKVPQTPSSGTVLRRPAGPLEP
SSDMAALSPLTSSGRQEQDTEPGSAHIAGMASSLTPPRGPVSPSVSFQPLTRSIPRASRL
PGPSVSAPPTGISSSSPGLASSGGAGDHGEATICPGAGVLASSLTTSVAPSKVPTNSAFD
RTMPSKLPASSKPSGTMSTNVLTSLPPSKLPINSTRAGTVAPKVPTGLVPDHRMSTSTAP
STVPANTVPPVRSSISSGETPPVAPEPTGTSTRDSLPEPDHNPATWGSELELSKPGRLVS
HMDSEPFSGCSADLALSCSKSLGAGPDNAPEENEYQSVESIRIQVAQDPSINLVEGSPGP
PAAPQPSVKDKFVPARFYAPWLGAAAAGALFAMLLAVLYRRRL
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgacgtttgctgaggacaagacttacgactatatccgccaccattacagcaattttggt
catattcatgttctggagattctgccttatctgtcctgcctcacaataagtgaccaggac
cgactgcgggcctactaccagctctgggggaaccagggcaccctctgggagctcttcaac
agccttcggcggcggactggctgggtggaatccttcatcaaggccctgaggatctgtgag
ctggccggtcttgctgacgaagtggcctctgtctaccagagcaacctgcccggggtcccg
aagaactgccccccagccccactggagccacagttagctcctgctgaggttccagggccc
tccacacctgccgtggcccccagcgccccccacaatggctacagagaggaggagtcaagt
ttccccatgcctgtccaggacactgagccgccagggtccctaggagagagttcaaagaaa
gtcccacagacacccagttctgggactgtcctgaggaggccagctggccccctggagccc
tcctctgacatggcagccctcagccctctgacctccagtgggcgtcaggagcaggacaca
gaaccaggcagtgcccacatagcaggcatggcctccagcctcacaccaccccgtgggcct
gtgtctccatctgtctccttccagccactgacccgttccatccccagggcaagccgcttg
ccaggaccctcagtatcagctccgcctactggcatctcctcctcttcccctggcttggcc
tcttcagggggtgctggtgaccatggtgaggctaccatctgccctggggccggggtgttg
gccagctcattgaccaccagcgtggcaccctccaaagtgcctaccaactcagcatttgat
agaacgatgccttccaagttgcctgccagctcgaaaccctctggcacaatgtctactaac
gtgctcactagtctaccaccatccaaactgcctatcaactccacacgtgctggcacagtg
gcacccaaggtgcctactggcttggtgcctgaccacaggatgtccacaagcacagcgccc
agcacggtgcctgccaacacagtgccccccgtcaggagcagcatatcctcaggggagact
cctccagtggctccagagcccacaggcacctctaccagagacagcttgcccgagccagac
cacaaccctgccacctggggctccgagttggagctgagcaagcctggccggctggtctcc
cacatggacagtgagccgttctcaggctgctctgcggacctggccctcagctgcagcaag
tccttgggcgcagggcctgacaacgccccagaggagaatgagtaccagtcagtggagtcc
attaggatccaagtggcccaggatcccagcattaacctggtagagggtagtcccgggcct
cctgctgccccacagccctcagtcaaggacaagtttgtcccggccagattctatgctcca
tggcttggggcagctgcagctggggctctcttcgccatgctcttggctgtgctgtatagg
cggcgcctgtga

DBGET integrated database retrieval system