KEGG   Felis catus (domestic cat): 101085995
Entry
101085995         CDS       T02385                                 
Symbol
CASP10
Name
(RefSeq) caspase-10
  KO
K04400  caspase 10 [EC:3.4.22.63]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04210  Apoptosis
fca04622  RIG-I-like receptor signaling pathway
fca04668  TNF signaling pathway
fca05152  Tuberculosis
fca05161  Hepatitis B
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101085995 (CASP10)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101085995 (CASP10)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    101085995 (CASP10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    101085995 (CASP10)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101085995 (CASP10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    101085995 (CASP10)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.63  caspase-10
     101085995 (CASP10)
Peptidases and inhibitors [BR:fca01002]
 Cysteine peptidases
  Family C14: caspase family
   101085995 (CASP10)
SSDB
Motif
Pfam: Peptidase_C14 DED
Other DBs
NCBI-GeneID: 101085995
NCBI-ProteinID: XP_019694018
Ensembl: ENSFCAG00000004733
UniProt: M3W2Q5
LinkDB
Position
C1:188122437..188180077
AA seq 482 aa
MTSQGQSLRFRSDDNCQVNFREKLLIIDSNLEAQDVEGLKFLCRDWISHKKLEKSSSASD
IFDHLLAEELLSEEDPFFLAELLYILKQNSLLRYLRQSREQVESLLPTRRRVSLFRNLLY
ELSEGIGSENLKDMVFLMRESIPKIQMTSLSFLAYLEKQALIDEDNLMLLEDLCRKVVPN
LMRKIEKYKREKASQVVTPPVDQETESLHQGEEEVFSRSDVNQFFGALQEATVYRMDRKH
RGHCVVVNNHSFTSLSDRPGTHRDAECLERVFQWLGFSVHIYNNVTKGRLDEVLKEYKSH
PGHADGDCFVFCVLTHGKFGAVYSSDEALVPIREIMSHFTAQQCPGLAHKPKLFFIQACQ
GEEIQPSVSIEADAVNSEHSPPTPSLLASVPSDADFLLGLATVPGYVSFRHVEEGSWYIQ
SLYNNLKNLVPRHEDILSILTAVNNDVSQQANKEGTKRQMPQPAYTLRKKLVFPVPQEKL
LL
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgacatctcaaggtcaaagtttgaggttccgttcagatgataattgtcaagtgaacttc
cgtgagaagcttctgattattgattcaaacctggaggcccaagatgtggagggcttgaag
tttctctgccgagactggatctcccacaagaagctggagaagtccagctcagcctcggat
atttttgatcatctgttggcagaggagctgctgagtgaggaagaccccttcttcctagca
gaactcctctatatactcaaacagaattcgctgctgcggtacctccgccaaagcagagag
caagtggagagtttgctgcccacccgaaggagggtctctctgttcagaaacctgctgtac
gaactgtcagagggaatcggctcagagaacttaaaggacatggtcttccttatgagggaa
tcgattcccaaaatccagatgacctctctaagtttcctggcatatctggagaaacaagct
ctaatagatgaagataatctgatgttactggaggatctctgcagaaaagttgtacctaac
cttatgagaaagatagaaaaatataagagagagaaagcctcccaggtagtgacacctcct
gttgaccaggaaactgagtcattgcatcaaggagaggaagaagtattttcccgttcagat
gttaaccaattctttggagccttacaggaagcaactgtgtacagaatggatcggaagcac
agaggccactgtgttgttgtcaataaccacagctttacctcactctcagatcgaccaggg
actcatagagatgctgagtgcttggagcgtgtgtttcagtggctggggttcagcgtacat
atatataataatgtgaccaaaggacgtctagatgaggttctgaaggaatataagagtcat
ccaggccatgctgatggagattgctttgtgttctgtgttctgacccatgggaaatttgga
gctgtctactcctcagatgaggcccttgttcccattcgggagatcatgtctcatttcaca
gcccagcagtgccctggcctggctcataaacccaaactcttttttatccaggcctgtcag
ggtgaagagatacaaccttctgtatccattgaagcagatgctgtaaattccgagcattca
cctcctaccccttcccttctggccagtgttcccagtgatgcagatttccttcttggcctg
gccactgtccctggctatgtatcctttcggcatgtagaggaaggcagctggtatattcag
tctctgtataataatctgaagaacttggtcccaagacatgaagatatcttatccatcctc
actgctgtcaacaatgatgtgagtcaacaagcaaacaaagaaggaacaaagagacagatg
ccccaacctgcttatacactacggaaaaaactagtattccctgtgccacaggaaaaactt
ttattgtag

DBGET integrated database retrieval system