KEGG   Felis catus (domestic cat): 101086282
Entry
101086282         CDS       T02385                                 
Symbol
IKBKE
Name
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit epsilon isoform X1
  KO
K07211  inhibitor of nuclear factor kappa-B kinase subunit epsilon [EC:2.7.11.10]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04625  C-type lectin receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04936  Alcoholic liver disease
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05171  Coronavirus disease - COVID-19
fca05207  Chemical carcinogenesis - receptor activation
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101086282 (IKBKE)
   04621 NOD-like receptor signaling pathway
    101086282 (IKBKE)
   04622 RIG-I-like receptor signaling pathway
    101086282 (IKBKE)
   04623 Cytosolic DNA-sensing pathway
    101086282 (IKBKE)
   04625 C-type lectin receptor signaling pathway
    101086282 (IKBKE)
   04657 IL-17 signaling pathway
    101086282 (IKBKE)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    101086282 (IKBKE)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101086282 (IKBKE)
   05160 Hepatitis C
    101086282 (IKBKE)
   05171 Coronavirus disease - COVID-19
    101086282 (IKBKE)
   05164 Influenza A
    101086282 (IKBKE)
   05162 Measles
    101086282 (IKBKE)
   05168 Herpes simplex virus 1 infection
    101086282 (IKBKE)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101086282 (IKBKE)
   05169 Epstein-Barr virus infection
    101086282 (IKBKE)
   05165 Human papillomavirus infection
    101086282 (IKBKE)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101086282 (IKBKE)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101086282 (IKBKE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101086282 (IKBKE)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     101086282 (IKBKE)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   101086282 (IKBKE)
SSDB
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD PK_Tyr_Ser-Thr ABC1 Pkinase_fungal Kinase-like APH CoV_S2 TMF_DNA_bd
Other DBs
NCBI-GeneID: 101086282
NCBI-ProteinID: XP_006942986
Ensembl: ENSFCAG00000013778
LinkDB
Position
F1:46591050..46623746
AA seq 754 aa
MQSTVNYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTASYLRPREVQVREFDVLR
KLNHQNIVKLFAVEETVGPVLGQREVVLSLTHTGWKDSGHRIMEMWSHACQQGGSRQKVL
VMEYCSGGSLLSVLESPENAFGLPEDEFLVVLRCVVAGMNHLRENSIVHRDIKPGNIMRL
MGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYLHPDMYERAVLRKPQQKTFGVTVDL
WSIGVTLYHAATGSLPFVPFGGPRRNKEMMYRITTEKPAGAIAGTQRRENGPLEWSYTLP
ITCRLSMGLQSQLVPILANILEVEQAKCWGFDQFFAETSDILQRVVVHVFSLSQAVLHHV
YIHAHNTVAIFLEAVYKQTSVAPQHQEYLFEGHVCVLEPSLSAQHIAHTTASSPLTLFSM
ASETPKGLAFRDPAQDIPKFFPKVDLQADYSTAKSVLGAGYQALWLAQALLAGQELMLRG
LYWFVEMLQATCRRTLEVTRMALLFLSSSLGTERFSSVAGMPEMQELKRVTELRSKLRAL
AEALSRYAHDITETQMSLSNLSSELMKNRDQVHADRSIQQIQCCLDKMNLIYKQFKKSRM
RPGLGYNEEQIHKLDKVNFGHLAKRLLQVFQEKCVQKYQTSLVTHGKWMREVHETRIHLR
MVSCSVAAFNTEAQGAQESLSKILDQLSHQLLQDRTMGAQVSEPPTAPHPSPALTDLVLH
MQELCEEVKLLAFDLQDNNRIIEGLSRPPSAPDS
NT seq 2265 nt   +upstreamnt  +downstreamnt
atgcagagcactgtcaattacctatggcacaccgacgacctgctggggcagggggccact
gccagtgtgtacaaggcccgaaacaagaaatccggggagctggttgccgtgaaggtcttc
aacaccgccagctacctgcgaccccgcgaggtgcaggtgagggagtttgatgtcctgcga
aagctgaaccaccagaacatcgtcaagctctttgcggtggaggagacggtgggtccagtg
cttggtcagagggaggtggtcttgtccttgacccacacaggctggaaagactcaggtcac
agaatcatggagatgtggtcacatgcttgtcagcaggggggcagccggcagaaggtgctg
gtgatggagtactgctctggtgggagcctgctgagcgtgctcgaaagccccgagaacgcc
ttcgggctgccggaggatgagtttctggtggtgctgcgctgtgtggtggccggcatgaac
cacctgcgggaaaacagcattgtccaccgtgacatcaagcctggaaacatcatgcgcctc
atgggggaggaggggcagagcatctataagctgacggacttcggggccgcccgggagctg
gatgacgatgagaagtttgtctctgtctatggcactgaggagtacctgcaccctgacatg
tatgaacgggcagtgcttcgcaagccccagcagaagacatttggggtgaccgtggatctc
tggagcattggggtaaccctgtaccacgcagccaccggcagcctgcccttcgtccccttc
ggtggaccacggcgcaacaaggagatgatgtaccggatcaccacggagaagccggccggg
gccatcgcaggcactcagaggcgggagaacgggcccctggagtggagttacaccctcccc
atcacctgccggctgtccatggggctgcagagccagctggtgcccatcctggccaacatc
ctggaggtggagcaggccaagtgctggggcttcgaccagttctttgcggagaccagtgac
atcctgcagcgagttgttgtccatgtcttctccctgtcccaggcggtcctgcaccacgtc
tacatccacgcccacaacacggtagccatctttctggaagccgtgtacaagcagaccagt
gtggccccccagcatcaggagtacctctttgagggtcacgtctgtgtccttgagcccagc
ctctcagcgcagcacatcgcccacacgacagcaagcagccccctgaccctattcagcatg
gccagcgagacccccaaggggctggccttcagggaccccgctcaggacatccccaagttc
ttccccaaagtggacctgcaggcggattacagcactgccaagagcgtgttgggcgctggc
taccaggccctgtggctggcgcaggccctgctggccgggcaggaactaatgcttcggggg
ctgtactggttcgtggagatgctccaggccacatgcaggcggacgctggaggtcacgcgg
atggccctcctgttcctcagcagcagcctgggcactgagaggttcagcagtgtggctggg
atgcctgaaatgcaggaactgaagagagtcacagagctgaggtccaagctgcgggctttg
gctgaggccctctccagatatgcccacgatatcacagagacccagatgagcctaagcaac
ctgagctctgagctgatgaagaaccgggatcaggtacatgcggacagaagcatccagcag
attcagtgctgtttggacaagatgaacctcatctacaaacagttcaagaaatccagaatg
aggccaggcctcggctacaacgaggagcagattcacaagctggataaggtgaatttcggt
catttagccaaaaggctcctgcaggtattccaggagaagtgcgtgcagaagtaccagaca
tctctagtcacgcacggcaagtggatgagggaggtgcacgagaccaggatccacttgcgt
atggtcagctgttctgtggctgcctttaacacagaagcccagggagcccaggagagcctc
agcaagatccttgaccagttatctcaccagctccttcaggacagaacaatgggggctcag
gtctcagaaccccccacagctccccaccccagccctgcactgacagacctggttctgcac
atgcaggagctctgcgaggaggtgaagctgctggccttcgaccttcaggacaacaaccgc
atcattgaagggttaagtaggcccccgtcggctcctgactcctga

DBGET integrated database retrieval system