KEGG   Felis catus (domestic cat): 101087550
Entry
101087550         CDS       T02385                                 
Symbol
FCGR2B
Name
(RefSeq) Fc fragment of IgG, low affinity IIb, receptor (CD32)
  KO
K12560  low affinity immunoglobulin gamma Fc receptor II-b
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04380  Osteoclast differentiation
fca04662  B cell receptor signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05162  Measles
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101087550 (FCGR2B)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    101087550 (FCGR2B)
   04666 Fc gamma R-mediated phagocytosis
    101087550 (FCGR2B)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101087550 (FCGR2B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    101087550 (FCGR2B)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101087550 (FCGR2B)
   05152 Tuberculosis
    101087550 (FCGR2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101087550 (FCGR2B)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101087550 (FCGR2B)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    101087550 (FCGR2B)
CD molecules [BR:fca04090]
 Proteins
  101087550 (FCGR2B)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig Ig_4 I-set Ig_5 EACC1 Protocadherin DUF202 MerC DUF6479 LapA_dom DUF2681
Other DBs
NCBI-GeneID: 101087550
NCBI-ProteinID: NP_001277169
Ensembl: ENSFCAG00000008160
UniProt: S6BBE9
LinkDB
Position
F1:complement(65669328..65684898)
AA seq 297 aa
MQIPSTRPLPAARSDRAECVPCPPLGDMLLWTALLFLGPVLGTPGLPKAVVDLEPPWILV
LREDDVTLKCQGAHTAGDHSIRWFHNGSSIPTQVRPNYSFKATEKDRGEYACQTDQTSLS
DPVYLDVFSDWLVLQTPSLVFQKGEPIVLRCHSWRNKPLYKITFFQNGKSKQFSPTNSTF
SIPRANLSHSGEYHCTGLIGKSLQASQPVAITVQGSSWSDSSVTVMIAVTVAGIAAVAIL
AAVVAWFRHRQKQTSANLTDAEDAAKVEAENAITYSLLLHPEAIEEEAEDPDYQNHI
NT seq 894 nt   +upstreamnt  +downstreamnt
atgcagatcccttcaacccgccccctccctgctgcccgtagtgaccgagccgagtgtgtg
ccctgcccccctttgggcgacatgctactgtggacagctctgctcttcttgggtccagtc
cttgggacacctggtctcccgaaggctgtggtggacctggagcccccgtggatcctcgtg
ctccgggaggacgatgtgactctgaagtgccagggggcccacacagccggggaccactcc
atccggtggttccataatgggagctccatccccacgcaggtccggcccaactacagcttt
aaggccaccgagaaggatagaggggagtacgcgtgccagacggaccagaccagcctcagt
gaccccgtgtatctggacgtgttttccgactggctggtgctccagacccctagcctggtg
ttccagaagggggagcccatcgtgctgaggtgccacagctggaggaacaagcctctgtac
aagatcacgttcttccagaatggaaaatccaagcagttttcccccacgaattccaccttc
tccatcccacgggcaaacctcagtcacagcggcgagtaccattgcacaggactgataggg
aagagtctgcaggcgtcacagcccgtggccatcaccgtccaagggtccagttggagcgac
tcctcagtgacggtgatgattgcggtcacggtcgctggcattgctgccgtggccatcctt
gctgccgttgtggcctggttccgccacaggcaaaagcagacttcagccaatctcacggat
gctgaagatgccgccaaagttgaggctgagaatgccatcacctattcacttctcttgcac
ccggaagccatagaggaagaagcagaggacccggattaccagaaccacatttaa

DBGET integrated database retrieval system