KEGG   Felis catus (domestic cat): 101087657
Entry
101087657         CDS       T02385                                 
Symbol
NLRC4
Name
(RefSeq) NLR family CARD domain-containing protein 4
  KO
K12805  NLR family CARD domain-containing protein 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca04621  NOD-like receptor signaling pathway
fca05132  Salmonella infection
fca05134  Legionellosis
fca05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101087657 (NLRC4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101087657 (NLRC4)
   05135 Yersinia infection
    101087657 (NLRC4)
   05134 Legionellosis
    101087657 (NLRC4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:fca04054]
    101087657 (NLRC4)
Pattern recognition receptors [BR:fca04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   101087657 (NLRC4)
SSDB
Motif
Pfam: NACHT NLRC4_HD CARD NOD2_WH AAA_16 ABC_tran
Other DBs
NCBI-GeneID: 101087657
NCBI-ProteinID: XP_019683264
Ensembl: ENSFCAG00000005995
LinkDB
Position
A3:116873141..116900311
AA seq 1042 aa
MLRCTFYVNKSMCVFPPISSVNFIKENSQVLIQRMGMTVIKQIVDELFVWNVLNYEEVSV
ICCEKVEQDAARGIIHMILKKGSESCNLFLKSLEKWNYPLFQDLNGQSLSKQMSEEVLDD
LAQSLKYLYNTPSFLNFYPLGEDFDIIFNLKSTFTEPVLWKKDHHHHRLEQLTLDGLLDT
LQSPCIIEGESGKGKSTLLQQIAMLWASGTCGALTKFKLVFFVRLSRAQGGLLETLCDQL
LDIPDTIRKQTFMAMLLKLRQRVLFLLDGYNEFKAQNCPEMEALIKENHRFKNTVIVTTT
TECLRHIRQFGALIAEVGDMTEDSAQTLIREVLMKEHAEGLLLQIRKSRCLRNLMKTPLF
VVITCVIQMGESKFHSYTQTTLFRTFYDLLIQKNKYKLKGLDAGDFAQSLNHCGDLALEG
VFSHRFDFQPEDMSSVNEDVLLTTGLLCKYTAQQFKPKYKFFHNSFQEYIAGRRLSSLLK
SQEPEEVTKGKGYLQKMVFISDITSKYSNLLLYTCGSSPEATRTVLEHLAAVYQHGSLLG
LSVTQKPLWRQESIQNVKNTTVQETLKAINISSFTECGINLFHESISKSDLSKEFEAFFC
GKSLYINSENIPDYLFDFFEHLPNCASALDFIKLDFYGEAMALRDTTTEDTSRTQEGSSE
TYIPSRAVSLFFNWKQEFKTLEVTLRDFSKLNKQDIKYLGKIFSSAKNLRLCIKRCAGVA
GSFSLVLRTCKNIYSLILEASPLTIEDEQHITSVTNLKTLSIQDLQTPRLPGGLTDSLGN
LKNLMKLILYNIKMNEEDAIKLAEGLTNLKKLCLLHMTHLSDIGKGMDYIVKSLSAEPCD
LEEIQLVSCCLTANAMKTLAQNLHNLAKLSILDLSENHLEKDGNEALHELIDRLYILEQL
TVLMLPWWSDVRVSLTRLLEQLEGALRLIKLGLKNWRLTDAEIRILGAFFEKKPLKNFQQ
LDLAGNCVSSDGWLGFMNVFQNLKQLVFFYFSTTRFLPDAALVRKLGHVLSKLTFLQEGR
LVGWQFDDDDISVIKGAFKLLT
NT seq 3129 nt   +upstreamnt  +downstreamnt
atgctgagatgtacattttacgtaaataaatcgatgtgtgtgtttccccccatctcctca
gtgaatttcataaaggagaatagtcaagtgctcattcaaaggatgggaatgactgttata
aagcaaattgtggacgagctatttgtgtggaatgttctgaattacgaagaagtaagtgtc
atttgctgtgaaaaggttgagcaggatgctgcaagagggatcattcacatgattctgaag
aagggttcggaatcctgtaacctctttctcaaatcccttgaaaaatggaactatcccctg
tttcaggacttgaatggacaaagtctttctaagcagatgtcagaagaagtcttagatgat
ttggctcagagtctaaagtatttatacaatactccatctttcctgaacttctatcctctg
ggtgaagacttcgacattatttttaatttgaaaagcaccttcacagaacctgttctatgg
aagaaggaccatcaccatcaccgattggagcagctgaccctggatgggctgctagacact
cttcagagtccctgcatcattgagggggaatcaggcaaagggaagtccactctgctgcag
caaatcgccatgctctgggcttccggaacgtgtggggctctcaccaagttcaaattagtc
ttttttgtccgtctgagcagggcccagggtgggctccttgaaactctgtgtgatcaactc
ctggatatacctgacaccatcaggaagcagactttcatggccatgctgctgaagctacgg
cagagagttctgtttcttcttgatggctacaatgaattcaaggcccagaactgcccagag
atggaagccctcataaaggagaaccaccgcttcaagaatacggtcattgtcaccaccacc
actgagtgcctgagacacatcaggcagtttggtgccctgattgccgaggtaggggacatg
acagaggacagtgcccagactctcatccgagaagtgctgatgaaggagcatgctgaaggc
ttgttgctccaaattaggaaatccagatgtttgaggaacctgatgaagacccctctcttc
gtggtcatcacttgtgtaatccagatgggggaaagcaagttccactcctacacacaaaca
acactgttccgcaccttctatgacctgctgatacagaagaacaagtacaaacttaagggg
ctggatgcaggtgacttcgctcagagcctgaaccactgtggagacctagctctggagggt
gtgttctcccacaggtttgatttccaaccggaggacatgtccagtgtgaacgaggatgtc
ctactgacaactggactcctctgtaaatacacagctcaacagttcaagccaaagtataaa
ttctttcataactccttccaggagtacatagcaggacgcagactcagcagtttgctgaag
tctcaagagccagaggaagtgaccaaggggaaaggttatttgcagaaaatggttttcatt
tcagacattacatccaagtatagcaacctgctcctgtacacatgtggatcatctcctgaa
gccaccaggactgttctggaacaccttgcagcagtgtatcaacatggcagcctccttggg
ctctctgtcacccagaagcctctctggaggcaggagtctatacaaaatgtgaaaaacacc
accgtgcaagaaactctgaaagccataaacatcagttcctttacagagtgtggcattaat
ctattccatgagagtatatccaaatcagacctgagtaaagaatttgaagctttcttttgt
ggcaaaagcttatatatcaactcagagaacatccccgattacttatttgacttctttgaa
cacttgcctaattgtgcaagtgctctggacttcattaaactggacttctacggagaagct
atggctttgagggacacgaccacagaagacacaagcaggactcaggaagggtcctcagaa
acctacattcccagcagggctgtgtctttgttcttcaactggaagcaggaattcaagact
ctggaggtcacactccgggacttcagcaagttgaataaacaagatatcaaatatctggga
aagatattcagttctgctaaaaacctcagattgtgcattaagagatgtgctggtgtggct
ggaagctttagtttggtcctccgcacctgtaagaacatttattctctcatcctggaagcc
agtcctctcaccatagaagatgagcagcatatcacatccgtgacaaacctaaaaaccttg
agtattcaggacctacagactccacggctgccaggtggtctgactgacagcttgggtaat
ttgaagaatcttatgaagctcatactgtacaacattaagatgaatgaggaagatgcgata
aaattagctgaaggtctgacaaacctgaagaagttgtgtttacttcatatgacccacttg
tctgacattgggaagggaatggattacatagtaaagtctctgtcagctgaaccctgtgac
cttgaagaaatccaattagtctcctgctgcctgactgccaatgctatgaaaaccctagct
cagaatcttcacaatttggccaaactgagcattcttgatttatctgaaaatcacctggaa
aaggatggaaatgaagctctacatgaactgattgacaggctgtacatcctggaacagctg
actgtgctcatgttgccctggtggagtgatgtacgagttagtctgaccaggctgttggag
caactggagggggccctgcggctcatcaagcttgggctgaaaaactggagactcacagat
gcagagattagaattctaggtgcattctttgaaaagaaacctctgaaaaacttccagcag
ctggatttggcaggaaattgtgtgagcagtgatggatggcttggcttcatgaacgtattt
cagaatcttaagcaattagtttttttttacttcagtactacaagatttttacctgatgca
gcattagtcagaaaacttggccatgtgttatctaagttaacttttttgcaagaaggtagg
cttgttgggtggcagtttgatgatgatgatattagtgttattaaaggtgcttttaaacta
ttaacttaa

DBGET integrated database retrieval system