KEGG   Felis catus (domestic cat): 101088688
Entry
101088688         CDS       T02385                                 
Symbol
TIRAP
Name
(RefSeq) toll/interleukin-1 receptor domain-containing adapter protein isoform X1
  KO
K05403  toll-interleukin 1 receptor (TIR) domain-containing adaptor protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04064  NF-kappa B signaling pathway
fca04620  Toll-like receptor signaling pathway
fca04936  Alcoholic liver disease
fca05132  Salmonella infection
fca05133  Pertussis
fca05152  Tuberculosis
fca05161  Hepatitis B
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101088688 (TIRAP)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101088688 (TIRAP)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101088688 (TIRAP)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101088688 (TIRAP)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101088688 (TIRAP)
   05133 Pertussis
    101088688 (TIRAP)
   05152 Tuberculosis
    101088688 (TIRAP)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101088688 (TIRAP)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101088688 (TIRAP)
SSDB
Motif
Pfam: TIR_2 TIR
Other DBs
NCBI-GeneID: 101088688
NCBI-ProteinID: XP_011284796
Ensembl: ENSFCAG00000025191
LinkDB
Position
D1:23304840..23321438
AA seq 246 aa
MASSTSSAPRSRSRKPLGKMADWFRQALSKKPKKILESSDGPSSDVSQPSSQDHPPRLGL
SSTSSPTHVVASSSGSSSGSSGRWSKDYDVCVCHSEEDLAAAQELVSYLEGSTASLRCFL
QLRDATPGGAIVSELCQALSNSHCRVLLITPGFLQDPWCKYQMLQALSEAPGAEGRTIPL
MSGLARAAYPAELRFMYFVDGRGPDGGFRQVKEAVMRCKLSGICRPSADTSITMGPRKLE
QSRKSS
NT seq 741 nt   +upstreamnt  +downstreamnt
atggcatcatcaacctcctcagctcctcgctcccggtccaggaagcctctgggcaagatg
gctgactggttcaggcaggccctgtcgaagaagcccaagaagatactggaatcctcagac
ggcccctccagtgacgtctcacagccgagctcccaggaccaccccccacgcctgggcctc
agctcaacctcgtctccaacacacgtggtcgccagcagcagcggcagcagcagcggcagc
agcggccgctggagcaaggactacgatgtctgtgtgtgccacagcgaggaggacctggca
gccgcccaggagctggtctcctacctggaaggcagcaccgccagcctgcgctgcttcctg
cagctgcgggatgcaaccccaggcggcgccatcgtgtccgagctgtgccaggcactgagc
aacagtcactgccgcgtgctgctcatcaccccaggcttcctgcaggacccgtggtgcaag
taccagatgctgcaggccctgagtgaggctcccggggcggagggccgcaccatccccctg
atgtcaggcctcgccagagccgcctaccccgctgagctccggttcatgtacttcgtggac
ggccggggccccgacggtggctttcgccaagtcaaggaagctgtcatgcgttgtaagcta
tcagggatctgcagaccatcagctgacacttctatcaccatgggacccagaaagttggag
caaagccggaaatcgagttag

DBGET integrated database retrieval system