KEGG   Felis catus (domestic cat): 101089421
Entry
101089421         CDS       T02385                                 
Symbol
ICAM1
Name
(RefSeq) intercellular adhesion molecule 1 isoform X1
  KO
K06490  intercellular adhesion molecule 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04064  NF-kappa B signaling pathway
fca04514  Cell adhesion molecules
fca04650  Natural killer cell mediated cytotoxicity
fca04668  TNF signaling pathway
fca04670  Leukocyte transendothelial migration
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05143  African trypanosomiasis
fca05144  Malaria
fca05150  Staphylococcus aureus infection
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05323  Rheumatoid arthritis
fca05416  Viral myocarditis
fca05417  Lipid and atherosclerosis
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101089421 (ICAM1)
   04668 TNF signaling pathway
    101089421 (ICAM1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101089421 (ICAM1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101089421 (ICAM1)
   04670 Leukocyte transendothelial migration
    101089421 (ICAM1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101089421 (ICAM1)
   05164 Influenza A
    101089421 (ICAM1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101089421 (ICAM1)
   05169 Epstein-Barr virus infection
    101089421 (ICAM1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101089421 (ICAM1)
  09174 Infectious disease: parasitic
   05144 Malaria
    101089421 (ICAM1)
   05143 African trypanosomiasis
    101089421 (ICAM1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101089421 (ICAM1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101089421 (ICAM1)
   05418 Fluid shear stress and atherosclerosis
    101089421 (ICAM1)
   05416 Viral myocarditis
    101089421 (ICAM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101089421 (ICAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101089421 (ICAM1)
   04090 CD molecules [BR:fca04090]
    101089421 (ICAM1)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101089421 (ICAM1)
   04091 Lectins [BR:fca04091]
    101089421 (ICAM1)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101089421 (ICAM1)
CD molecules [BR:fca04090]
 Proteins
  101089421 (ICAM1)
Glycosaminoglycan binding proteins [BR:fca00536]
 Hyaluronan
  Cell surface receptors
   101089421 (ICAM1)
Lectins [BR:fca04091]
 I-type lectins (Siglecs)
  101089421 (ICAM1)
SSDB
Motif
Pfam: ICAM_N Ig_2 Ig_3 ig I-set C2-set_2
Other DBs
NCBI-GeneID: 101089421
NCBI-ProteinID: XP_003981899
Ensembl: ENSFCAG00000009431
LinkDB
Position
A2:7786375..7795856
AA seq 532 aa
MALGTARPALPALLALIGALLPGLGGAQTSVHPLEAIIPRGGSVQVNCSTSCDHRPFLGL
ETQLTKKEVAQGDNWKMFELTGVQEDSTPICFSSCQAQTMVSMSLTVYWFPERVELAPLP
RWQPVGENLILRCQVAGGAPRTNLTVVLLRGEEELSRQPAVGEPAEATVTVLAGRDDHLA
NFSCRTELDLRSRGLGLFQNSSAPRQLRTFVLPATHPNLVTPSVVEAGTEWPVNCTMDGL
FPASEAQVRLELSGRNLHPTVTHNNDSLLATAHDKANMEEEGTRQLSCVVTLGHQSRSWQ
ENVTIYSFPAPNLTLSEPEVSEQTVVTVECEAQAGALVMLSGGVPARLPGPRAQLQLNAS
AEDNGRIFFCSALLEVAGQVLRKNQTRELRVLYGPRLDKRDCLGNWTWQEGSQQTLTCQA
RGNPVPELKCRRKGDNALLPIGDLRPVTREVAGTYLCQARSPRGEVTREVVVNVIYHRNY
ILTTILVTVAFTIGAAGLAAYFYNRQRKIQKYKLQKAQEAAAMKLNTPATPP
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggctctcggcaccgcccgtcccgcgctgccagcgctcctggccctgatcggagctctg
ctcccaggacttggaggggcccaaacatcagtgcaccccctagaagccatcataccccga
ggcggctctgtgcaggtgaactgtagtacttcttgtgaccatcgccccttcttgggcctg
gagacgcagctgactaagaaggaggtcgctcagggggacaactggaagatgtttgaactg
actggtgtgcaggaagatagcaccccaatatgcttctcatcctgtcaagcacagacaatg
gtttcgatgtctctcaccgtgtactggttcccggagcgcgtggagttggcccccctgccc
cgctggcagcccgtgggcgaaaacctcatcctgcgctgccaggtggccggcggggcgccc
cggaccaacctcacggtggtgctgctccgcggggaggaggagctgagccggcagccggcc
gtcggggagcccgccgaggccacggtcacggtgctggcgggcagagacgaccacctcgcc
aatttctcgtgccgcacggaactggacttgcggtcccgagggctgggtctgttccagaac
agctcggcccccaggcagctccgaactttcgtcctgccagcaacgcacccaaaccttgtt
acccccagcgttgtggaagcgggcacagagtggcccgtgaactgcaccatggacgggctg
ttcccagcttcggaggcccaagtccgcctggagctgtctggccggaatctgcaccccaca
gtcacgcacaacaacgactccctcttggccacggcccatgacaaggccaacatggaagag
gagggcacccggcagctgtcgtgcgtggtgaccctgggacaccagagccggtcgtggcag
gagaatgtgaccatctacagcttcccggctcccaacctgaccctgagtgagccagaggtc
tcagaacagactgtggtgaccgtggagtgtgaagcccaggccggggccctggtgatgctg
agcgggggggtcccggcaaggcttccaggacccagggcccagctccaactaaatgccagc
gccgaggacaatgggcgcatcttcttctgctctgctctcctggaggtggctgggcaggtg
ctacgcaagaaccagacccgggagctccgtgtcctgtatggtccccgactagacaagagg
gattgtctgggaaactggacgtggcaggaaggctcccagcagaccctgacatgccaagcc
cggggaaatccagttcctgagctgaagtgtcgccggaagggggataatgctctgctgccc
atcggggacctgagacctgtcacgcgggaggttgcaggcacttacctgtgtcaggccagg
agcccccgtggtgaggtcacccgtgaagtggtcgtgaacgtgatctaccaccggaattac
atcctcaccaccattctggtgacagttgctttcaccataggagctgcgggcctagctgct
tacttctataaccgccagcggaagatccagaaatacaagttacagaaggcccaggaggcg
gctgccatgaagctgaacacaccagccacgccaccctga

DBGET integrated database retrieval system