KEGG   Felis catus (domestic cat): 101089493
Entry
101089493         CDS       T02385                                 
Symbol
GSDMD
Name
(RefSeq) gasdermin-D
  KO
K20917  gasdermin-D
Organism
fca  Felis catus (domestic cat)
Pathway
fca04613  Neutrophil extracellular trap formation
fca04621  NOD-like receptor signaling pathway
fca05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101089493 (GSDMD)
   04621 NOD-like receptor signaling pathway
    101089493 (GSDMD)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101089493 (GSDMD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fca02000]
    101089493 (GSDMD)
Transporters [BR:fca02000]
 Other transporters
  Pores ion channels [TC:1]
   101089493 (GSDMD)
SSDB
Motif
Pfam: Gasdermin Gasdermin_C
Other DBs
NCBI-GeneID: 101089493
NCBI-ProteinID: XP_023104116
LinkDB
Position
F2:84639777..84646485
AA seq 591 aa
MTSTFERVVKSVVRELDPKGDLIPVDSLRSSISFRPYCLLGRKLSSSWFWKPRYKCLNLS
IRDILEPDAPEPAVERVASFHIEDLVDGMVEGNVEVKALGQGKFVSGAAVSATASTSVNV
CMLKVPLNTWGAMKKERRLRQPEHKILQQLRSCGNDVFVVTEVLQTQEEVEVTRAQKQEG
CGQFALPGALRLQGKGQGHLNRKKTVTIPSGSVLAFQTALLVIGPDWEIHHLRHKDERTF
RLPQTGHKPTSSTGLLSQIPLSFFKMRFPSTPVDMVSDGDIEDQMPVTEDFQGLKVEVSV
HADGLKGLSGELCGQILAGLMKVLREEPALESLQEELEQGLCCGWVASPDAPGGAILECL
VQSSGKVEEELARPILYLVQALTELNETQRVLLAEALETGDLSGQSRLVQSVLEQSSPWK
EHRAVSLPQELLGSSWDSEAPAWVLLEECGLELRVDVPQVHWQPDAQGRTSALYACLVLL
PHLSQDQLNETQRVLLAEALETGDLSGQSRLVQSVLEQSSPWKEHRAVSLPQELLGSSWD
SEAPAWVLLEECGLELRVDVPQVHWQPDAQGRTSALYACLVLLPHLSQDRA
NT seq 1776 nt   +upstreamnt  +downstreamnt
atgacgtccaccttcgaaagggtggtcaagagcgtggtccgggagctggaccccaaagga
gacctcatccccgtggacagcctgcggagctccatcagcttccggccctactgcctgctg
ggcaggaagctgtccagctcatggttctggaaaccccgctacaagtgtctcaacctgtcc
atcagggacattctggagcctgatgccccagaaccagctgtggaacgcgtcgcctctttc
cacatcgaagacctcgtggacgggatggtggagggcaacgtggaggtgaaagcgctggga
cagggcaagtttgtgagcggggcagcggtgtcggccacagccagcacctccgtgaacgtg
tgcatgctgaaagtgcccctcaacacctggggggccatgaaaaaagaaaggcgcctgcgg
cagccggagcacaagatcctgcagcagctgcggagctgcgggaacgacgtgttcgtggtg
acggaggtgctgcagacgcaggaggaggtggaggtcacccgggcccagaagcaggagggc
tgtggccaattcgccctgcccggagccctacgcctgcagggcaagggccagggccacctg
aaccggaagaagacagtcaccatcccctcaggcagcgtccttgcattccagacggccctg
ctggttattggccctgactgggagatccaccacctccggcacaaggacgagaggaccttc
aggctgccccagacaggccacaagcctacaagcagcacaggtctcctgtcacagatacct
ctcagcttcttcaagatgaggttcccatctacacccgtggacatggtgtcggatggggac
attgaggaccagatgccagtcactgaagactttcagggcctgaaggtagaggttagtgtc
cacgccgacggcctgaagggcttgtccggggaactgtgcgggcagatcctggcaggcctg
atgaaggtgttgcgggaagagccggccttggagagcctccaggaggagctggaacagggc
ctgtgctgtgggtgggtggcgtcccccgatgccccggggggtgccatcctggagtgcctg
gtgcagtcctctggaaaggtagaggaagaactcgcccgccccatcctctacctcgtacaa
gcactgactgagctgaacgaaacccagcgtgtactgctcgcggaggcgctggagacaggg
gacctgtccgggcagtccaggctggtgcagagcgtcctggagcagagctccccctggaag
gagcacagggctgtgtccctgccgcaggagctcctggggagcagctgggactcagaggca
cctgcctgggtcctgctggaggagtgcggcctggagctgcgggtggacgtcccccaggtg
cactggcagccggacgcgcagggccgcacgagcgccctctacgcctgcctggtgctgctg
ccgcatctgagccaggaccagctgaacgaaacccagcgtgtactgctcgcggaggcgctg
gagacaggggacctgtccgggcagtccaggctggtgcagagcgtcctggagcagagctcc
ccctggaaggagcacagggctgtgtccctgccgcaggagctcctggggagcagctgggac
tcagaggcacctgcctgggtcctgctggaggagtgcggcctggagctgcgggtggacgtc
ccccaggtgcactggcagccggacgcgcagggccgcacgagcgccctctacgcctgcctg
gtgctgctgccgcatctgagccaggaccgcgcttag

DBGET integrated database retrieval system