KEGG   Felis catus (domestic cat): 101089832
Entry
101089832         CDS       T02385                                 
Symbol
IL6ST
Name
(RefSeq) interleukin-6 receptor subunit beta isoform X1
  KO
K05060  interleukin 6 signal transducer
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04630  JAK-STAT signaling pathway
fca04659  Th17 cell differentiation
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101089832 (IL6ST)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101089832 (IL6ST)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101089832 (IL6ST)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101089832 (IL6ST)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101089832 (IL6ST)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101089832 (IL6ST)
   05203 Viral carcinogenesis
    101089832 (IL6ST)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101089832 (IL6ST)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101089832 (IL6ST)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101089832 (IL6ST)
   04090 CD molecules [BR:fca04090]
    101089832 (IL6ST)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL6/12 receptor family
   101089832 (IL6ST)
CD molecules [BR:fca04090]
 Proteins
  101089832 (IL6ST)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind IL6Ra-bind Pur_ac_phosph_N fn3_2 ObR_Ig
Other DBs
NCBI-GeneID: 101089832
NCBI-ProteinID: XP_011281197
Ensembl: ENSFCAG00000010859
UniProt: M3WE28
LinkDB
Position
A1:complement(126562088..126617728)
AA seq 918 aa
MLTLKTWIVQALFIFFTTESVGELLEPCGHIKPESPVVQLGSNFTAVCVLKEKCMDYFHV
NANYIFWKTNHVTVPKEQYTIINRTASSVTFTDISLLNIQLTCNIRTFGQIDQNVYGIRI
ISGLPPEKPKNLSCIVNEGKKMMCQWDPGRETYLETNFTLKSEWATEKFADCKTKRDTPT
SCTVDYSPVYFVNIEVWVEAENALGKVTSDHINFDPVDKVKPNPPHNLSVSNSEELSSIL
KLTWINSSIQSFIRLKYNIQYRTRDASTWSQIPPEDTASSRTSFTVQDLKPFTEYVFRIR
CMKEDGKGFWSDWSEEASGITYEDRPSKAPSFWYKIEPSHTHGYRSVQLIWKTLPPFEAN
GKILDYEVTLIRWKSRLQNYTVNDTKWTVNLTNDRYIATLTARNLVGKSDAAVLTIPAYN
FQATRPVTDLKAFPKDNMLWVEWTAPNESVNKYILEWCVLSDKSPCIPDWQQEDGTVHRT
FLRGNLAESKCYLITVTPVYTDGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWD
QLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGG
KDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSK
SHIAQWSPHTPPRHNFNSKDQIYSDGNFTDVSVVEIEAANDKKPFPEDLKSLDLFKKEKI
STEGHSSGIGGSSCMSSSRPSISSSDENESAQNTSGTVQYSTVVHSGYRHQVPSVQVFSR
SESTQPLLDSEERPEDLQLVDNTDSSVGNLPRQQYFKQNCSQRETSPDISHFERSKQVSS
VNEEDFVRLKQQISDISQSCGSGQMKMFQEISVADAFGLHTEGQVERFETVGMEAAVDEG
MSKSYLPQTVRRGGYMPQ
NT seq 2757 nt   +upstreamnt  +downstreamnt
atgttgacattgaaaacttggatagtgcaagcgttgtttattttcttcaccactgaatct
gtaggtgaacttctagagccatgtggtcatatcaaacctgaatctccagttgtacaactt
ggttctaatttcactgcagtttgtgtgctaaaggaaaaatgcatggattattttcatgta
aatgctaattacattttctggaaaacaaaccatgttactgttcctaaagaacaatatacc
atcataaacagaacagcatctagtgtcacatttacagatatatctttattaaatattcaa
ctcacttgcaacattcgtacatttggacagattgatcagaatgtttatggaatcagaata
atttcaggcttgcctccagaaaaacctaaaaacttgagttgcattgtaaatgaaggaaag
aaaatgatgtgtcagtgggatcctggaagggaaacatacctggaaacaaacttcacttta
aaatctgaatgggcaacggagaagtttgctgattgtaaaacaaaacgtgacacccccacc
tcatgcactgttgattattctcctgtgtattttgtcaacattgaagtctgggtagaagca
gagaatgcccttgggaaggttacatcagatcatataaattttgatcctgtagataaagtg
aagcccaatccaccacataatttatcagtcagcaactcagaggaactgtctagtatctta
aaattgacatggatcaactcaagtattcagagttttataagactgaaatataacattcaa
tataggaccagagatgcctcaacctggagccagattcctcctgaagatacagcatccagt
agaacttctttcactgtccaggaccttaagcctttcacagaatatgtgtttaggattcgt
tgtatgaaggaagatggtaaaggattctggagtgactggagtgaagaagccagtgggatc
acatatgaagacagaccatccaaggcaccaagtttctggtataagatagagccatcccat
actcacggctatagatctgtgcaactcatatggaagacgttgcctccttttgaagccaat
ggaaaaattttggattatgaagtgactctcataagatggaaatcacgtttacagaattat
acagtgaatgacacaaaatggacagtaaacctcacaaatgatcgttacatagcaactctg
acagcaagaaatctggttggcaaatcagatgcagctgttttaactatccctgcctataac
tttcaagctactcgcccggtcacggatcttaaagcatttcccaaagataatatgctttgg
gtagaatggactgctccaaatgaatctgtaaacaagtatatacttgagtggtgtgtatta
tcagataaatcgccgtgcatcccagactggcaacaagaagatggcactgtacaccgcacc
tttctaagagggaacctagcagagagcaaatgttatttgataacagttactccagtatat
actgatggaccaggaagccctgagtctataaaggcataccttaaacaagctccaccttcc
aaaggacctactgttcggacgaaaaaagtagggaaaaatgaagctgtcttagagtgggac
caacttcctgttgatgttcagaacggatttatccgaaattatactatattttatagaacc
atcattggaaatgaaactgctgtgaatgtggattcctcccacacagaatatacactgtcc
tctttgaccagtgacaccttgtacatggtacgaatggcagcatacacagacgaaggtgga
aaggatggcccagaattcacttttactacaccgaagtttgctcaaggagaaattgaagcc
atagttgttcctgtttgcctagcatttctattgacaacccttttgggagtattgttctgc
tttaataagcgagacctaattaaaaaacatatctggcctaatgttccagatccttcaaag
agtcatattgcccagtggtcacctcatacacctcctaggcataattttaattcaaaagat
cagatttactcagatggcaatttcactgatgtaagtgtcgtggagatagaagcagcaaat
gacaaaaagccttttccagaagatctgaaatcactggacttattcaagaaggaaaaaatc
agtactgaaggacacagcagtggtattggaggttcatcgtgcatgtcctcctctaggcca
agcatttctagcagtgatgaaaatgagtctgcccagaacacttcaggcaccgtccagtat
tccacagtggtgcacagtggctacagacaccaggttccatcggtccaagtcttctcaaga
tccgagtccacccagcccttgttagattctgaagagcggccagaagatctacagctggta
gataacacagatagcagtgttggcaatttgcccaggcaacagtatttcaaacaaaactgc
agtcaacgtgaaaccagtccagatatttcacattttgaaaggtcaaagcaagtttcgtca
gtcaatgaagaagattttgttagactcaaacagcagatttcagatatttcacagtcctgt
ggatctgggcaaatgaaaatgtttcaagaaatttctgtagcagatgcttttggtctacat
actgagggacaggtagagagatttgaaacagttgggatggaggctgcagttgatgaagga
atgtctaaaagctacttaccacaaactgtcagacgaggtggctacatgcctcagtga

DBGET integrated database retrieval system