KEGG   Felis catus (domestic cat): 101090239
Entry
101090239         CDS       T02385                                 
Symbol
IL2RG
Name
(RefSeq) cytokine receptor common subunit gamma
  KO
K05070  interleukin 2 receptor gamma
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04144  Endocytosis
fca04151  PI3K-Akt signaling pathway
fca04630  JAK-STAT signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca05162  Measles
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05321  Inflammatory bowel disease
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101090239 (IL2RG)
   04151 PI3K-Akt signaling pathway
    101090239 (IL2RG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101090239 (IL2RG)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101090239 (IL2RG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101090239 (IL2RG)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101090239 (IL2RG)
   04659 Th17 cell differentiation
    101090239 (IL2RG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101090239 (IL2RG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101090239 (IL2RG)
   05162 Measles
    101090239 (IL2RG)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101090239 (IL2RG)
   05340 Primary immunodeficiency
    101090239 (IL2RG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101090239 (IL2RG)
   04090 CD molecules [BR:fca04090]
    101090239 (IL2RG)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL2 receptor family
   101090239 (IL2RG)
CD molecules [BR:fca04090]
 Proteins
  101090239 (IL2RG)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind
Other DBs
NCBI-GeneID: 101090239
NCBI-ProteinID: XP_004000651
UniProt: M3WLD0
LinkDB
Position
X:complement(60411656..60415380)
AA seq 369 aa
MLKPPLPLRSLLFLQLPLLGVGLNSTGPKPNGNEDITADFFLTATPPAALSVSTLPLPEV
QCFVFNVEYMNCTWNSSSEPHPTNLTLHYWYKNSNDDRVQECGHYLFSGEITSGCWLQKE
EIHLYETFVVQLQDPREPKRQSTQRLKLQNLVIPWAPENLTLRNLSETQLELTWSNRHLD
HCLEHLVQYRSDWDRSWTEQSVDHRHSFSLPSVDGQKFYTFRVRSRYNPLCGSAQRWSEW
SRPIHWGSNTSKENPLLFAMEAVLIPLGSVGLIISLICVYCWLERTMPRIPTLKNLEDLV
TEYHGNFSAWSGVSKGLAESLQPDYSEWLCHVSEIPPKGGAPGEGPGGSPCSQHSPYWAP
PCYTLKPEP
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgttgaagccaccattgccactcagatccctcttattcctgcagctgcctctgctgggg
gtggggctgaattcgacaggccccaagcccaatgggaatgaagacatcacagctgatttc
ttcctgaccgctacaccccctgcggccctcagtgtttccactctgcccctcccagaggtc
cagtgttttgtgttcaatgttgagtacatgaattgcacttggaacagcagctctgagccc
catcccaccaacctgactctgcactattggtacaagaactccaatgatgatagagtccag
gagtgtggccactatctattctctggagagatcacttctggctgctggctgcaaaaagag
gagatacatctctatgaaacatttgttgtccagctccaggacccacgggaacccaagagg
cagtccacacagaggctgaaattgcagaatctggtgatcccctgggctccggagaaccta
acgcttcgcaacctgagcgaaacccagctagaactgacctggagtaacagacacttggac
cactgtctggagcaccttgtgcagtaccggagtgactgggaccgcagctggacagaacaa
tcagtggaccacagacatagcttctctctgcctagcgtggatgggcagaaattctacacg
ttccgtgtccggagccgctataacccactctgtggaagcgctcagcgttggagtgaatgg
agccgcccgatccactggggcagcaatacttcaaaggagaatcctttgttgtttgcaatg
gaagctgtgcttatcccccttggctccgtgggattgattattagccttatctgtgtgtac
tgctggctggaacggacgatgccccggattcctaccctcaagaacctagaggatctggtt
actgaataccacgggaacttttcggcctggagtggagtatctaagggactggcggagagt
ctgcagccagactacagtgaatggctctgccacgtcagtgagattcccccaaaaggaggg
gctccaggggaggggcctgggggctccccctgcagccagcatagcccctactgggctccc
ccgtgttacaccctgaaaccggagccctga

DBGET integrated database retrieval system