KEGG   Felis catus (domestic cat): 101091813
Entry
101091813         CDS       T02385                                 
Symbol
PTEN
Name
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00562  Inositol phosphate metabolism
fca01100  Metabolic pathways
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04068  FoxO signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04071  Sphingolipid signaling pathway
fca04115  p53 signaling pathway
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04218  Cellular senescence
fca04510  Focal adhesion
fca04931  Insulin resistance
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05206  MicroRNAs in cancer
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05222  Small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05230  Central carbon metabolism in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101091813 (PTEN)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101091813 (PTEN)
   04070 Phosphatidylinositol signaling system
    101091813 (PTEN)
   04071 Sphingolipid signaling pathway
    101091813 (PTEN)
   04151 PI3K-Akt signaling pathway
    101091813 (PTEN)
   04150 mTOR signaling pathway
    101091813 (PTEN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101091813 (PTEN)
  09143 Cell growth and death
   04115 p53 signaling pathway
    101091813 (PTEN)
   04218 Cellular senescence
    101091813 (PTEN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101091813 (PTEN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101091813 (PTEN)
   05206 MicroRNAs in cancer
    101091813 (PTEN)
   05208 Chemical carcinogenesis - reactive oxygen species
    101091813 (PTEN)
   05230 Central carbon metabolism in cancer
    101091813 (PTEN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101091813 (PTEN)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101091813 (PTEN)
   05214 Glioma
    101091813 (PTEN)
   05218 Melanoma
    101091813 (PTEN)
   05215 Prostate cancer
    101091813 (PTEN)
   05213 Endometrial cancer
    101091813 (PTEN)
   05224 Breast cancer
    101091813 (PTEN)
   05222 Small cell lung cancer
    101091813 (PTEN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101091813 (PTEN)
   05165 Human papillomavirus infection
    101091813 (PTEN)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101091813 (PTEN)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101091813 (PTEN)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101091813 (PTEN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101091813 (PTEN)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101091813 (PTEN)
    3.1.3.48  protein-tyrosine-phosphatase
     101091813 (PTEN)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     101091813 (PTEN)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    101091813 (PTEN)
SSDB
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3 DUF3256
Other DBs
NCBI-GeneID: 101091813
NCBI-ProteinID: XP_019669784
Ensembl: ENSFCAG00000019200
LinkDB
Position
D2:7565534..7659710
AA seq 388 aa
MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRCAERH
YDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMI
CAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHLDYRPVALLF
HKMMFETIPMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKV
EFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEY
LVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEASSSTSVTPDVSDNEPD
HYRYSDTTDSDPENEPFDEDQHTQITKV
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgacagccatcatcaaagagatcgttagcagaaacaaaaggagatatcaggaggatgga
ttcgacttagacttgacctatatttatccaaacattattgctatggggtttcctgcagaa
agacttgaaggcgtatacaggaacaatattgatgatgtagtaaggtgtgctgaaagacat
tatgataccgccaaatttaactgcagagttgcacagtatccttttgaagaccataaccca
ccgcagctggaacttatcaaacccttttgtgaagatcttgaccaatggctcagtgaagat
gacaatcatgttgcagcaattcactgtaaagctggaaagggacgaactggtgtaatgatt
tgtgcatatttattgcatcggggcaaatttttaaaggcacaagaggccctagatttctat
ggggaagtaaggaccagagacaaaaagggagtaactattcccagtcagaggcgctatgtt
tattattatagctacctgttaaagaatcatctggattatagaccagtggcactgttgttt
cacaagatgatgtttgaaactattccaatgttcagtggcggaacttgcaatcctcagttt
gtggtctgccagctcaaggtgaagatctattcctccaattcgggacccacacgacgggaa
gacaagttcatgtacttcgagttccctcagccgctgcctgtgtgtggtgacatcaaagta
gagttcttccacaaacagaacaagatgctaaaaaaggacaaaatgtttcacttttgggta
aatacattcttcataccaggaccagaggaaacctcagaaaaagtagaaaatggaagtcta
tgtgatcaagaaattgatagtatttgcagtatagagcgtgcagataatgacaaggaatat
ctagtactcactttaacaaaaaatgatctcgacaaagcaaataaagacaaggccaaccga
tacttttctccaaattttaaggtgaagctgtacttcacaaaaacagtagaggagccatca
aatccagaggctagcagttcaacttctgtaacaccagatgttagtgacaatgaacctgat
cattatagatattctgacaccactgactctgatccagagaatgaaccttttgatgaagat
cagcatacacaaattacaaaagtctga

DBGET integrated database retrieval system