KEGG   Felis catus (domestic cat): 101092286
Entry
101092286         CDS       T02385                                 
Symbol
IFNGR2
Name
(RefSeq) interferon gamma receptor 2 isoform X1
  KO
K05133  interferon gamma receptor 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04066  HIF-1 signaling pathway
fca04217  Necroptosis
fca04380  Osteoclast differentiation
fca04630  JAK-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca05140  Leishmaniasis
fca05142  Chagas disease
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05164  Influenza A
fca05168  Herpes simplex virus 1 infection
fca05200  Pathways in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101092286 (IFNGR2)
   04066 HIF-1 signaling pathway
    101092286 (IFNGR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101092286 (IFNGR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101092286 (IFNGR2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101092286 (IFNGR2)
   04658 Th1 and Th2 cell differentiation
    101092286 (IFNGR2)
   04659 Th17 cell differentiation
    101092286 (IFNGR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101092286 (IFNGR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101092286 (IFNGR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101092286 (IFNGR2)
  09172 Infectious disease: viral
   05164 Influenza A
    101092286 (IFNGR2)
   05168 Herpes simplex virus 1 infection
    101092286 (IFNGR2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101092286 (IFNGR2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101092286 (IFNGR2)
   05140 Leishmaniasis
    101092286 (IFNGR2)
   05142 Chagas disease
    101092286 (IFNGR2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101092286 (IFNGR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101092286 (IFNGR2)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IFN receptor family
   101092286 (IFNGR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 101092286
NCBI-ProteinID: XP_006935986
LinkDB
Position
C2:complement(11921768..11949358)
AA seq 352 aa
MRPPPLLPPLSLLLLLFGGRGAAAPSADSLSQLPAPRNPKVRLYNAERVLSWEPVSLSND
TRPVVYQVQHKYRSGSTWFDLGDKGEVNCMNITTTECDFTPKGNSVFPRLEFDTFLRVRA
KVDDLVSPWLTVPSFRYCRNVTVGPPENIWVTPGEGSLIIRLSSPFDVRAFSATFLYYVH
YWEKAGIQQVKGPFRSTSIVLNDLKPLREYCLQVKAQLVCEKGNISRPGHLSNVSCYKTA
MDAATKVQQIIVIAVGLFLFLSMLAGACFFLVLKYRGLVKYWFHSPPSIPLQIEEYLKDP
AQPILEALDKDSSPKDDAWDSVSVVSFPEKEQEDVLQSTLHQSPGPVQQPVG
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgcggccgccgccgctcctgccgccgctgtcgctgctgctgctgctgttcggcggccgc
ggcgccgcggcgccctccgcagactctctttcccagctgcctgctcctcgaaacccgaag
gttcgcctgtacaatgccgagcgggttctgagttgggagccggtgtccctgagcaatgac
acgaggccggtggtctaccaggtgcagcataaataccgtagtggcagtacgtggtttgac
ctcggcgacaagggggaggtaaactgtatgaacatcaccacaacagagtgtgacttcacc
ccaaaaggcaactcagtctttccgcgactggaatttgacacctttttacgtgttcgagcg
aaggtagacgacctggtttctccatggctgacagtgccttctttccggtactgtaggaat
gttaccgtcgggcctcccgaaaacatttgggtgacgccaggagaaggctcccttatcatc
aggctctcctctccctttgacgtccgtgccttctcggccacttttttgtattatgtccat
tactgggaaaaggcaggaatccaacaggttaaaggccccttcaggagcacctccatcgtg
ctgaatgatttgaaacccttaagagaatactgtttacaagtcaaagcgcaactggtttgt
gaaaaagggaacatctctagacccggacacttaagcaacgtatcttgctacaaaacagcg
atggatgccgccacaaaagtccagcaaatcatcgtgattgctgtgggactctttctgttc
ctgtcgatgctggcgggggcctgtttcttcctggtcctgaaatacagaggcctggtgaaa
tactggtttcactctccaccgagcatcccgttacaaatagaagagtatttaaaggacccg
gctcagcctatcttggaggccctggacaaggacagctcgccaaaggacgatgcctgggac
tctgtgtccgttgtttcgtttccagagaaggagcaagaagatgttctccagagtactttg
caccaaagccccggtccagtccagcagcctgtgggatga

DBGET integrated database retrieval system