KEGG   Felis catus (domestic cat): 101092339
Entry
101092339         CDS       T02385                                 
Symbol
JAK3
Name
(RefSeq) tyrosine-protein kinase JAK3
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04062  Chemokine signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04217  Necroptosis
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04630  JAK-STAT signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca05161  Hepatitis B
fca05162  Measles
fca05166  Human T-cell leukemia virus 1 infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05223  Non-small cell lung cancer
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101092339 (JAK3)
   04151 PI3K-Akt signaling pathway
    101092339 (JAK3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101092339 (JAK3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101092339 (JAK3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101092339 (JAK3)
   04659 Th17 cell differentiation
    101092339 (JAK3)
   04062 Chemokine signaling pathway
    101092339 (JAK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101092339 (JAK3)
   05203 Viral carcinogenesis
    101092339 (JAK3)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    101092339 (JAK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101092339 (JAK3)
   05161 Hepatitis B
    101092339 (JAK3)
   05162 Measles
    101092339 (JAK3)
   05169 Epstein-Barr virus infection
    101092339 (JAK3)
  09163 Immune disease
   05340 Primary immunodeficiency
    101092339 (JAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101092339 (JAK3)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101092339 (JAK3)
Protein kinases [BR:fca01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   101092339 (JAK3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl Kdo ABC1 APH Kinase-like Haspin_kinase
Other DBs
NCBI-GeneID: 101092339
NCBI-ProteinID: XP_023102969
Ensembl: ENSFCAG00000007517
LinkDB
Position
A2:complement(13178918..13194986)
AA seq 1106 aa
MAPPSEETPLIPQRSCSLSSSEAGALHVLLPPRGPGPPQRLSFSFGDHSAEELCVWAAKA
SGILPVYHSLFALATEDLSYWYPPSHIFSVEDASTQILLYRLRFYFPNWFGLEKCHRFGL
RKDLASAILDLPVLEHLFAQHRNDLVSGRLAVGLSLKEQGECLSLAVLDLARMAREQAQQ
PEELLKTVSYKACLPPDLRDLIQGLSFVTRKRIRRTVRRALGRVTACQADRHSLMAKYIM
DLERLDPARAAETFLVSLPGAAGGQDAPGLLRVAGDSGIHWSPGGHEALQPFCDFPEIVD
ISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGLPAALSFVALVDGYFRLTSDSRHFFC
KEVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSLPGSYVLRRSPQDFDSFLLTVCVQTP
LGPDYKGCLIRCDPTGTFSLAGLGRPHSSLRELLAACWDAGLHVDGVALNLTSCCAPRPK
EKSNLIVVRRGCSTPTSSLVWPQSQCQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCR
HEAVDGEARETEVLLKVMDAKHRNCMESFLEAASLMSQVSYQHLVLLHGVCMAGDSVMVQ
EFVRLGALDTYLRKSGHLVPASWKLQVIKQLAYALNYLEDKGLPHGNVSARKVLLAREGA
DGNLPFIKLSDPGVSPTVLSLEMLTDRIPWVAPECLQEARTLGLEADKWGFGATVWEVFS
GIPMPISTLDPAKKLQFYEERQHLPAPKWMELATLIQQCMAYEPGQRPSFRAIIRDLNSL
ITSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCR
YDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRL
VMEYLPSGCLRDFLQRHRARLDASRLLLYASQICKGMEYLGSRRCVHRDLAARNILVESE
THVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYEL
FTYGNKNCSPSAEFLRMMGCERDVPALCRLLELLAEGQRLPAPPACPGEVHELMKLCWAP
SPQDRPTFSALGPQLDTLWSGSRGVA
NT seq 3321 nt   +upstreamnt  +downstreamnt
atggcgcctccaagtgaggagacacccctgatccctcagcgttcctgcagcctctcgtct
tcagaggctggtgccctgcacgtgctgctgccccctcggggccccggacccccacaacgc
ctgtccttctcctttggggaccattcagctgaagagctatgtgtttgggctgctaaggcc
agtggcatcctgcctgtgtaccactccctctttgctctggccacggaggacctgtcctac
tggtaccccccgagccacatcttctccgtggaggatgcaagcacccaaatcctgctctac
aggctccgcttttacttccccaactggtttgggttggagaaatgccaccgcttcgggcta
cggaaggacttggccagtgccatccttgacctgccagtcctggagcacctcttcgcccag
caccgaaatgacctggtgagcggccgcctcgccgtgggcctcagtctcaaggagcagggt
gaatgtctcagcctggcagtgctggacctggctcggatggcccgtgagcaggctcagcag
cctgaggagctgctgaagaccgtcagctacaaggcctgcctgccccccgatctgcgcgac
ctgatccagggcctgagcttcgtgacgcggaagcgtatccggaggactgtgcgtcgggcc
ctgggccgcgtgaccgcctgccaggctgacaggcactcgctcatggccaagtacatcatg
gacctggagaggctggacccggccagggccgccgagaccttcctcgtgagcctccccggg
gctgctggtggccaggatgctccggggctgctccgagtggctggtgacagcggcatccac
tggagtccgggaggacacgaggccctccagcccttctgcgactttccagaaattgtggac
atcagcatcaagcaggctcctcgtgttggccccgccggggagcaccgcctggtcaccgtc
accaggacggacaaccagatcctggaggccgagttcccggggctgcccgcggccctgtcc
ttcgtggcgctcgtggatggctacttccggctgacttccgactccaggcacttcttctgc
aaggaggttgcgccgccgcggctgctggaggaggtggccgaacagtgccacggtcccatc
accctggattttgccatcaacaagctcaagaccgggggctcccttcccggctcctatgtt
ctccgccgcagcccccaggatttcgacagcttcctcctcactgtctgcgtccagaccccc
ctgggtcctgattacaagggctgcctcatccggtgtgaccccacgggaaccttctccctg
gctggcctcggccggccccacagcagtcttcgagagctcttggcagcctgctgggatgct
gggctgcacgtggatggggttgcgctgaacctcacctcctgctgcgcccccagacccaaa
gaaaagtccaacctgatcgtggtgcggagaggttgcagcactcccacatcatcccttgtt
tggccccaatcccagtgtcagctgagtcagatgacgtttcacaagatccccgctgacagc
ctggagtggcacgagaacctgggtcacgggtccttcaccaagatttaccgaggttgtcgc
catgaggctgtggacggggaagcccgggagacagaggtgctactcaaagtgatggatgcc
aagcacagaaactgcatggagtccttcctggaagcagcgagcctgatgagccaagtgtcg
tatcagcacctcgtgttgctccacggcgtgtgcatggctggagacagtgtcatggtgcag
gaatttgtgcgcctgggagccctggatacatatctgcgcaagtctggccacctggtacca
gccagctggaagctgcaggtgatcaaacagctggcctatgccctcaactatctggaagac
aaaggcctcccccatggcaatgtctcagcccggaaggtgctcttggctcgggagggggct
gacgggaacctgcccttcatcaagttgagtgaccctggtgtcagccccactgtgctgagc
ctggagatgctcactgacaggatcccctgggtggcccctgagtgtctccaggaggcccgg
acccttggcttggaagctgacaagtggggtttcggtgccacagtctgggaagtgttcagc
gggatcccgatgcccatcagtaccctggatcctgccaagaagctccagttttacgaggaa
cggcagcaccttcccgcccccaagtggatggagctggccaccctgatccaacagtgcatg
gcctatgagccaggccagaggccctccttccgtgccatcatccgtgacctgaacagcctc
atcacttcagattatgagctcctctcagaccccacacctggtgccttggcgccccgtgat
gggctgtggaatggcgcccagctctacgcctgccaggaccctaccatttttgaggagaga
catctcaagtacatctcacagctgggcaagggcaactttggcagcgtggagctgtgccgc
tatgacccgctgggcgacaacacgggcgccctagtggctgtgaagcagcttcagcacagc
gggccagaccagcagagggacttccagcgggagatccagatcctcaaagccctccacagc
gacttcattgtcaagtaccgcggtgtcagctatggcccgggccgccagagcctgcggctg
gtgatggagtacctgcccagcggctgcctgcgcgacttcctgcagcgacaccgcgcgcgc
ctggacgccagccgcctgctcctctacgcctcgcagatctgcaagggcatggagtacctg
ggctcccgccgctgcgtgcaccgcgacctggcggcccgtaacatcctggtggagagcgag
acgcacgtcaagatcgccgactttggcctcgccaagctgctgccgctcgacaaagactac
tacgtggtccgcgagcccggccagagccccatcttctggtacgccccagagtccctctct
gacaacatcttctcgcgccaatcggacgtctggagcttcggggtcgtcctgtacgaactt
ttcacctacggcaacaagaattgcagcccctcagccgagttcctccggatgatgggatgt
gagcgagacgtccccgccctctgccgcctcctggagctgctggctgagggccagaggctg
cccgcgcctcctgcctgccccggtgaggttcatgagctcatgaagctgtgctgggccccg
agcccgcaagatcggccaacattcagtgccctgggcccccagctggatacactgtggagt
ggaagccggggggtagcatag

DBGET integrated database retrieval system