KEGG   Felis catus (domestic cat): 101092621
Entry
101092621         CDS       T02385                                 
Symbol
HMOX1
Name
(RefSeq) heme oxygenase 1
  KO
K00510  heme oxygenase 1 [EC:1.14.14.18]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00860  Porphyrin metabolism
fca01100  Metabolic pathways
fca04066  HIF-1 signaling pathway
fca04216  Ferroptosis
fca04978  Mineral absorption
fca05200  Pathways in cancer
fca05206  MicroRNAs in cancer
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05225  Hepatocellular carcinoma
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    101092621 (HMOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101092621 (HMOX1)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    101092621 (HMOX1)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    101092621 (HMOX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101092621 (HMOX1)
   05206 MicroRNAs in cancer
    101092621 (HMOX1)
   05208 Chemical carcinogenesis - reactive oxygen species
    101092621 (HMOX1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101092621 (HMOX1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101092621 (HMOX1)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     101092621 (HMOX1)
SSDB
Motif
Pfam: Heme_oxygenase
Other DBs
NCBI-GeneID: 101092621
NCBI-ProteinID: XP_003989271
Ensembl: ENSFCAG00000028498
LinkDB
Position
B4:131976167..131996160
AA seq 288 aa
MERPQPDSMPQDLSEALKEATKEVHVQAENAEFMKNFQKGQVTRKGFKLVMASLYHIYVA
LEEQIERNKENPAYAPLYFPEELHRRAALERDMAFWYGPRWEDAIPYTQATRHYVRRLHE
VGRKEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGVDFFTFPNVASATKFKQ
LYRSRMNTLEMTPEVRQRVIEEAKAAFLLNIQLFEELQELLGQDAEDQSPSQAPGLRRRV
GSGARDAAPAETPRGKPQPNLLSQAPLLRWVLTLSFVVATVAVGLYVM
NT seq 867 nt   +upstreamnt  +downstreamnt
atggagcgcccgcagcccgacagcatgccccaggatttgtcagaggccctgaaggaggcc
accaaggaggtgcacgtccaggcagagaatgccgagttcatgaagaactttcagaagggc
caggtgacccggaaaggatttaagctggtgatggcctccctgtaccacatctacgtggct
ctggaggaacagatcgagcgcaacaaggagaaccccgcctatgcccccctctacttcccc
gaagagctgcaccgcagggccgccctggagcgggacatggccttctggtacgggccccgc
tgggaggatgccatcccctacacgcaggccaccaggcactacgtgcggcggctccacgag
gtggggcgcaaggagccggagctgctggtggcccacgcctacacccgctacctcggcgat
ctgtctgggggccaggtcctcaagaagattgctcagaaggccctggacctgcccagctcc
ggggagggcgtggacttcttcaccttccccaacgtcgccagcgccaccaagttcaagcag
ctgtaccgctcccgcatgaacactctggagatgacccctgaggtcaggcagagggtcatc
gaagaggccaaggctgcgttcctgctcaacattcagctgtttgaggagctgcaggagctg
ctgggccaggacgccgaggaccagagcccctcgcaggcaccggggctgcgccggcgggtc
ggcagcggggcgcgagatgctgctcccgcggagactcccagagggaagccccagccgaac
cttctctcccaggcgccgctcctccgatgggtccttaccctcagctttgtggtggcaacg
gttgccgtggggctttatgtcatgtga

DBGET integrated database retrieval system