KEGG   Felis catus (domestic cat): 101092622
Entry
101092622         CDS       T02385                                 
Symbol
IL2RB
Name
(RefSeq) interleukin-2 receptor subunit beta isoform X1
  KO
K05069  interleukin 2 receptor beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04144  Endocytosis
fca04151  PI3K-Akt signaling pathway
fca04630  JAK-STAT signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca05162  Measles
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101092622 (IL2RB)
   04151 PI3K-Akt signaling pathway
    101092622 (IL2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101092622 (IL2RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101092622 (IL2RB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101092622 (IL2RB)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101092622 (IL2RB)
   04659 Th17 cell differentiation
    101092622 (IL2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101092622 (IL2RB)
   05202 Transcriptional misregulation in cancer
    101092622 (IL2RB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101092622 (IL2RB)
   05162 Measles
    101092622 (IL2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101092622 (IL2RB)
   04090 CD molecules [BR:fca04090]
    101092622 (IL2RB)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL2 receptor family
   101092622 (IL2RB)
CD molecules [BR:fca04090]
 Proteins
  101092622 (IL2RB)
SSDB
Motif
Pfam: IL2RB_N1 fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 101092622
NCBI-ProteinID: XP_023113240
Ensembl: ENSFCAG00000008405
LinkDB
Position
B4:complement(133367536..133382547)
AA seq 551 aa
MDVMAAPGLPWCLSLLVLFLPLAIPRASTAVNDPSKLACFYNSKANISCVWSWDGDLQAT
SCRIHAKPDQRSWNKSCELLPMGSASWACYLILGSPDTQSLTSADTVDMRVMCHEGGRWR
VLMTQKFKPFENLRLMAPDSLQVTHVGTHRCNITWKVRQSSHYIERYLEFEARKRSPGHS
WEEASLLTLAQNQQWISLETLTPDTLYELQVRVRPQLGKNEAWSPWSQPLAFRTRPAAPG
KEAVPFPWLGHIIMGISSAFGFIISVYLLANCRYIGPWLKKVLKCHIPDPSEFFSQLKSV
HGGDFQQKWLSSPFPSSSFSPNTPAPEISPLEVLDRDAKATQLLLLQQEKVPSSSSAETS
GHSLTSCFTNQGYFFFHLPDALEIEACQVYFTYDPCTEEPDEAGPGAPAGSLLPPLLPPP
GEEDAYCTFLLGGPGPPNTAPGGTGAHDKKLAPSLQEGAPRDWAPRPPLSPPPGAPEPVD
IQPPLEGSVEGAREEGPGPGPGPGEGVRVSFPWASPPGQGQLRAPASCLTLNTDAYLSLQ
ELQDQDPARSG
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggatgtgatggcggctcctggtctgccctggtgtctgtccctccttgtcctcttcctg
cccctggccatccctcgggcatccacagcggtgaacgacccctccaagctcgcgtgtttc
tacaactcaaaagccaacatctcctgtgtctggagctgggatggggacctacaggccaca
tcctgcaggatccacgctaagccggatcaacggtcttggaacaaatcctgtgagctgctt
ccgatgggatcggcctcctgggcctgttacctgatccttggatccccagatactcagagt
ctgacttcggctgacaccgtggacatgagggtgatgtgccacgaaggggggaggtggagg
gtgctgatgacccagaaattcaagccctttgagaaccttcgcctgatggcccccgactcc
ctccaagtcactcacgtagggacccacagatgcaacataacctggaaagtccgccagtcc
tcccactacattgaaagatacctggagtttgaggcccggaaaaggtccccaggccacagc
tgggaggaggcctccctgctgaccctcgcgcagaaccagcaatggatttccctggagacc
ctcactccagacaccctgtatgaacttcaagtgcgggtcaggccccagctgggcaaaaac
gaggcttggagcccctggagccagcccctggccttcaggacgaggcccgcagccccaggg
aaggaggctgtgccctttccttggctgggccacatcatcatgggcatcagcagtgccttt
ggcttcatcatctcggtctacttgctggccaactgccggtacatcgggccatggctgaag
aaagttctgaaatgtcacatcccagatccctcagaattcttctcccagctgaagtcagtg
catggaggagatttccagcagaagtggctctcctctcccttcccctcgtcgtccttcagc
cccaacacgccggcccccgagatctccccgctggaggtgctggacagggacgccaaggcc
acacagttgctcctgctacagcaggagaaggtgccctcctcgtcctcagccgagaccagc
ggccactcgctgaccagctgcttcaccaatcagggctatttcttcttccacctcccggac
gctctggagatcgaggcctgccaggtgtacttcacctatgacccctgcacggaagagccc
gatgaggccgggcccggggcgcctgcggggtctctcctgccacccctgctgcctccgccc
ggggaggaagacgcctactgcaccttcctcctcggcggcccgggccccccaaacacggcc
ccggggggcactggagctcatgacaagaagctggccccctccctgcaggagggagctccc
agagactgggccccccggcccccgctgtctcccccgccaggtgcacctgagccggtggac
atccagccacccctggagggctccgtggaaggagcaagggaggagggcccgggcccgggc
cctggccctggggagggggtcagggtcagcttcccctgggccagccctcctgggcaaggc
cagctcagagcccctgcctcctgcctgaccctgaacaccgatgcctacctgtccctccag
gagctgcaggatcaggacccagctcgctcggggtag

DBGET integrated database retrieval system