KEGG   Felis catus (domestic cat): 101092689
Entry
101092689         CDS       T02385                                 
Symbol
THBS1
Name
(RefSeq) thrombospondin-1
  KO
K16857  thrombospondin 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04015  Rap1 signaling pathway
fca04115  p53 signaling pathway
fca04145  Phagosome
fca04151  PI3K-Akt signaling pathway
fca04350  TGF-beta signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca05144  Malaria
fca05165  Human papillomavirus infection
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101092689 (THBS1)
   04350 TGF-beta signaling pathway
    101092689 (THBS1)
   04151 PI3K-Akt signaling pathway
    101092689 (THBS1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101092689 (THBS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101092689 (THBS1)
  09143 Cell growth and death
   04115 p53 signaling pathway
    101092689 (THBS1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101092689 (THBS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    101092689 (THBS1)
   05205 Proteoglycans in cancer
    101092689 (THBS1)
  09162 Cancer: specific types
   05219 Bladder cancer
    101092689 (THBS1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101092689 (THBS1)
  09174 Infectious disease: parasitic
   05144 Malaria
    101092689 (THBS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101092689 (THBS1)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101092689 (THBS1)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Opsonins
    101092689 (THBS1)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   101092689 (THBS1)
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC cEGF EGF_3 TSP1_ADAMTS EGF_CA TSP1_CCN Laminin_G_3 Laminin_G_2 EGF
Other DBs
NCBI-GeneID: 101092689
NCBI-ProteinID: XP_011281379
Ensembl: ENSFCAG00000011449
UniProt: M3WF45
LinkDB
Position
B3:complement(65612772..65628495)
AA seq 1170 aa
MGLAWGLSVLFLLHVCGSNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDSSSPAFR
IEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLAIERKDHSGQVFSVV
SNGKAGTLDLSLTVQGMQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELD
VPIQSIFTRDLANVARLRIAKGGVNDNFQGVLQNVRFVFGTTPEAILRNKGCSSSTNVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRK
VTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECRCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACRRDACPINGGWGPWSLWDICSVTCGGGVQTRSRLCNNPTPQFGGKDCVGDATENQI
CNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCKDIDECKEVPDACF
NHNGEHRCENTDPGYNCLPCPPRFTGPQPFGRGVEYATANKQVCKPRNPCTDGTHDCNKN
AKCSYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNEDLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDNVPDIDDICPENIDISETDFRRF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDLKYECRDS
NT seq 3513 nt   +upstreamnt  +downstreamnt
atggggctggcctggggactcagtgtcctcttcctgttgcatgtatgtggctccaaccgt
attccagaatccgggggagacaacagcgtgttcgacatctttgaactcacgggcgctgcc
cggaagggctctgggcgccggctggtgaaggggcctgactcttccagcccagctttccgc
atcgaggatgccaacctgatcccccctgtgcctgatgacaagttccaagacctggtggat
gccgtgcgggcagagaaaggcttccttctcttggcctccctgaggcagatgaagaagacc
cgaggcacactgctggccatagaacggaaagaccactcgggccaggttttcagtgtggtc
tccaatggcaaggcgggcaccctggacctgagcctaaccgtgcaggggatgcagcatgtg
gtgtcggtggaagaagcgctcctggcgaccggccaatggaagagcatcaccctgtttgtg
caggaggacagggcccagctgtacatcgactgtgagaagatggagaacgccgagctggat
gtccccatccaaagcatcttcaccagggacctggccaacgttgccagactccgcatcgca
aaaggaggtgtcaatgacaatttccagggggtgctgcagaatgtgaggttcgtcttcgga
accacaccagaagccatcctcaggaacaaaggctgttcgagctctaccaatgttcttctc
acccttgacaacaacgtggtaaacggctccagccctgccatccggactaactacattggc
cacaagacaaaggatctgcaagccatctgtggcatttcgtgcgatgagctgtccagcatg
gtcctggagttgaggggcctgcgcaccatcgtgaccaccctccaggacagcatccgcaaa
gtgactgaagagaacaaggagttggccaatgagctaaggaggcctcccctctgctaccac
aacggagttcagtacaggaataacgaggaatggactgttgatagctgcacggagtgtcgc
tgtcagaactctgttaccatctgcaaaaaagtgtcctgccccatcatgccctgctccaat
gccacagttcccgatggagaatgctgcccacggtgttggcccagcgactctgcggatgat
ggctggtccccgtggtctgagtggacctcctgctctgtgacctgtggcaacggaatccag
cagcgcggtcgctcctgtgacagcctcaacaaccgctgcgagggctcctccgtccagact
cggacctgccacattcaggagtgtgacaagagatttaaacaggatggcggctggagccac
tggtccccgtggtcgtcttgttctgtgacatgcggtgacggtgtgatcacaaggatccga
ctctgcaattcccctagcccccagatgaacgggaagccgtgtgaaggcgaagctcgagag
accaaggcctgcaggagagacgcgtgccccatcaatggaggctggggtccctggtcactg
tgggacatctgttctgtcacctgcggaggaggggtgcagacacgtagccggctctgcaac
aaccccacaccccagtttggaggcaaggactgcgttggtgatgcgacagaaaaccagatc
tgcaacaagcaggactgtccaattgacggatgcctgtccaatccctgctttgctggggtc
aagtgtaccagttaccctgacggcagctggaaatgtggtgcttgtccccccggctacagt
ggaaatggcatccaatgcaaagacatcgatgagtgcaaagaagtacctgacgcctgcttc
aaccacaacggggagcacaggtgtgagaacacggacccgggctacaactgtctgccctgc
cccccacgcttcactggcccgcagcccttcggccggggtgtggaatatgccaccgccaac
aaacaggtatgcaagccccgcaacccctgcacagatgggacacacgactgcaacaagaac
gccaagtgcagctacctgggccattacagtgaccccatgtaccgctgtgagtgcaagccc
ggctacgcaggcaatggcatcatctgcggtgaggacacggacctggacggctggcccaac
gaggacctggtgtgcgtggccaatgccacctaccactgcaaaaaggataattgccccaac
cttcccaactccgggcaggaagactatgacaaggatggaattggcgacgcctgtgatgac
gacgacgacaatgataaaatcccagatgacagggacaactgtccattccactataaccca
gcccagtatgactatgaccgggatgacgtgggagaccgctgtgacaactgcccctacaac
cacaacccagatcaggctgacacagacaacaacggggaaggagatgcctgcgccgctgac
atcgacggggatggtatcctcaatgaacgagacaactgccagtacgtctacaacgtggac
cagagggacacggatatggatggggtcggcgatcagtgtgacaactgccccctggaacac
aatccagatcagctcgactctgactcagaccgcatcggagacacctgtgacaacaatcag
gatattgatgaagatggccaccagaacaacctggacaattgtccctatgtgcccaatgcc
aaccaggctgaccatgacaaggacggcaagggagacgcctgcgaccatgatgatgacaac
gatggcattcctgatgatagggacaactgcagactcgtgcccaatcctgaccagaaggat
tctgacggtgacggtcgaggtgatgcttgcaaagatgattttgaccatgacaatgtgcca
gacattgatgacatctgtcccgaaaacattgatatcagtgagaccgatttccgccgattc
cagatgattcctctagatcccaaagggacgtcccaaaatgaccctaactgggtggtgcgc
catcagggtaaagaactcgtccagactgtcaactgcgatccaggacttgctgtaggttac
gatgagtttaatgcagtggacttcagtggcaccttcttcatcaacactgagagggatgat
gactatgctggatttgtgtttggctaccagtctagcagccgcttttatgtggtgatgtgg
aagcaagtcacccagtcctactgggacaccaaccccactagggctcagggatactcaggc
ctttctgtgaaagtggtgaactccacaacagggccaggcgagcacctacggaacgccctg
tggcacacgggaaacacccccggccaggtgcgcactctgtggcatgaccctcgtcacata
ggctggaaagatttcactgcctacaggtggcgtctcagccaccgaccaaagacgggtttc
attagagtggtgatgtatgaagggaagaaaatcatggctgattcaggacccatctacgac
aaaacctatgctggaggtagactggggttgtttgtcttctctcaagaaatggtgttcttc
tccgacctgaaatacgaatgcagagattcctaa

DBGET integrated database retrieval system