KEGG   Felis catus (domestic cat): 101093644
Entry
101093644         CDS       T02385                                 
Symbol
IGF2
Name
(RefSeq) insulin-like growth factor II isoform X3
  KO
K13769  insulin-like growth factor 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04151  PI3K-Akt signaling pathway
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101093644 (IGF2)
   04014 Ras signaling pathway
    101093644 (IGF2)
   04151 PI3K-Akt signaling pathway
    101093644 (IGF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101093644 (IGF2)
   05205 Proteoglycans in cancer
    101093644 (IGF2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101093644 (IGF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101093644 (IGF2)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101093644 (IGF2)
Cytokines and growth factors [BR:fca04052]
 Growth factors
  Growth factors (RTK binding)
   101093644 (IGF2)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101093644 (IGF2)
SSDB
Motif
Pfam: IGF2_C Insulin
Other DBs
NCBI-GeneID: 101093644
NCBI-ProteinID: XP_019668406
LinkDB
Position
D1:115954564..115970248
AA seq 187 aa
MPMGVPMGKSMLVLLTFLALASCCFAAYRPSETLCGGELVDTLQFVCGDRGFYFRLPGRP
ASRVNRRSSRGIVEECCFRSCDLALLETYCAAPAKSERDVSTPPTVLPDNFPRYPVGKFF
QYDSWKQSAQRLRRGLPALLRARRGRMLAKELEAFREAKRHRPLIALPTHDPAAHGGASP
EASANRK
NT seq 564 nt   +upstreamnt  +downstreamnt
atgccgatgggggtcccaatggggaagtcgatgctggtgttgctcaccttcttggccttg
gcctcgtgctgctttgctgcttaccgccccagtgagaccctgtgcggcggggagctggtg
gacaccctccagtttgtctgtggggaccgcggcttttacttcagacttccaggcaggccg
gcgagccgcgtgaaccgccgcagcagccgtggcatcgtggaagagtgttgcttccgcagc
tgtgacctggcccttctggagacctactgcgccgcccccgccaagtccgagagggacgtg
tcgacccctccgaccgtgcttccggacaacttccccagataccccgtgggcaagttcttc
caatatgacagctggaagcaatcggcccagcgcctgcgcaggggcctgcctgccctcctg
cgcgcccgccggggtcgcatgctcgccaaggagctcgaggcgttcagagaggccaagcgt
caccgtcccctgatcgccctgcccacccacgaccccgccgcccacgggggcgcctctccg
gaggcgtccgccaatcggaagtga

DBGET integrated database retrieval system