KEGG   Felis catus (domestic cat): 101094121
Entry
101094121         CDS       T02385                                 
Symbol
PIKFYVE
Name
(RefSeq) 1-phosphatidylinositol 3-phosphate 5-kinase isoform X1
  KO
K00921  1-phosphatidylinositol-3-phosphate 5-kinase [EC:2.7.1.150]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00562  Inositol phosphate metabolism
fca01100  Metabolic pathways
fca04070  Phosphatidylinositol signaling system
fca04145  Phagosome
fca04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101094121 (PIKFYVE)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    101094121 (PIKFYVE)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101094121 (PIKFYVE)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101094121 (PIKFYVE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101094121 (PIKFYVE)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.150  1-phosphatidylinositol-3-phosphate 5-kinase
     101094121 (PIKFYVE)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Macropinocytosis
   Kinases
    101094121 (PIKFYVE)
 Endosome - Golgi transport
  Others
   Others
    101094121 (PIKFYVE)
SSDB
Motif
Pfam: PIP5K Cpn60_TCP1 DEP FYVE 3-alpha
Other DBs
NCBI-GeneID: 101094121
NCBI-ProteinID: XP_019694119
LinkDB
Position
C1:194627337..194715285
AA seq 2111 aa
MATDDKTSPTLDSANDLPRSPTSPSHLTHFKPLTPDQDEPPFKSAYSSFVNLFRFNKERV
EGGQGEQPSLSGSWTSPQLPSRTQSVRSPTPYKKQLNEELQRRSSAVLEENSLQHPQENT
DTRRKAEPAFGGHDPRTAVQLRSLSTVLKRLKEIMEGKSQDSDLKQYWMPDSQCKECYDC
SEKFTTFRRRHHCRLCGQIFCSRCCNQEIPGKFMGYTGDLRACTYCRKIALSYAHSTDSN
SIGEDLNALSDSASSVSVLDPNEPRTPVGSRKASRNIFLEDDFAWQSLIHPDSSNTPLST
RLVSVQEDAGKSPARNRSASITNLSLDRSGSPMVSSYETSVSPQANRTYVRTETTEDERK
ILLDSVQLKDLWKKICHHSSGMEFQDHRYWLRTHPNCIVGKELVNWLIRNGHIATRAQAI
AIGQAMVDGRWLDCVSHHDQLFRDEYALYRPLQSTEFSETPSPDSDSVNSVEGHSEPSWF
KDIKFDDSDTEQIAEEGDDNLTNSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFH
IKKPSKYPHVPPHPADQKEYLISDNGGQQLSISDAFIKESLFNRRVEEKSKELPFTPLGW
HHNNLELLREENGEKQAMERLLSANHNHMMALLQQLLHNESLSPSWRDIIVSLVCQVVQT
VRPDVKNRDDDMDIRQFVHIKKIPGGKKFDSVVVNGFVCTKNIAHKKMNSCIKNPKILLL
KCSIEYLYREETKFTCIDPIVLQEREFLKNYVQRIVDVRPTLVLVEKTVSRIAQDMLLEH
GITLVINVKSQVLERISRMTQGDLVMSMDQLLTKPHLGTCHKFYMQIFQLPNEQTKTLMF
FEGCPQHLGCTIKLRGGSDYELARVKEILIFMICVAYHSQLEISFLMDEFAMPPTLTQNP
SFHSLIEGREDEGTAQEPFSGSPLPREPDFPPEFLPSDDSSLLESRIVFEKGDQENRSIP
QDVACLKHQEYATAACPAGIPCALFPSVPESLLPLHVDDQQDAVGLEQPEALQHPDELQD
PKSQMRAFRDPLQDDTGLYVTEEVTSSEDKRKTYSLAFKQELKDVILCISPVITFREPFL
LTEKGMRCSTRDYFAEQVYWSPLLNKEFKEVESRRKKQLLRDLSGLQGMNGSVQAKAIQV
LPSHELVSTRIAEHLGDSQSLGRMLADYRARGGRIQQKNADPFAHSKDVPGTSSGRSGSK
TDGDEEKGLIPSDAVWSTKVDCLNPVNHQRLCVLFSSSSAQSSNAPSACVSPWIVTMEFY
GKNDLTLGIFLERYCFRPSYQCPSMFCDTPMVHHIRRFVHGQGCVQIILKELDSPVPGYQ
HTILTYSWCRICKQVTPVVALSNESWSMSFAKYLELRFYGHQYTRRANAEPCGHSIHHDY
HQYFSYNQMVASFSYSPIRLLEVCVPLPKIFIKRQAPLKVSLLQDLKDFFQKVSQVYLAV
DERLASLKTDTFSKTREEKMEDIFAQKEMEEGEFKNWVEKMQARLMSSSADAPQQLQSIF
ESLIAKKQSLCEVLQAWNNRLQDLFQQEKGRKRPSVPPSPGRLRQGEESKISAMDAAPRN
ISPGLQNGEKEDRFLTTLSSQSPASSAHLQLPTPPEALPEQLAGAPPELDTASSSEDVFD
GHLLGSTDSQVKEKSTMKAIFANLLPGNSYNPIPFPFDPDKHYLMYEHERVPIAVCEKEP
SSIIAFALSCKEYRNALEELSKATQRNSAEEGLPTNSTLDSRPKSSSPIRLPEVSGGQTN
RTAEAEPQPTKKTSGMLSFFRGTAGKSPDLSSQKRETLRGADSAYYQVGQTGKEGTENQG
AESQDEVDGGDTQKKQLINPHVELQFSDANAKFYCRLYYAGEFHKMREVILGSSEEDFIR
SLSHSSPWQARGGKSGAAFYATEDDRFILKQMPRLEVQSFLDFAPHYFNYITNAVQQKRP
TALAKILGVYRIGYKNSQNNTEKKLDLLVMENLFYGRKMAQVFDLKGSLRNRNVKTDTGK
ESCDVVLLDENLLKMVRDNPLYIRSHSKAVLRASIRSDSHFLSSHLIIDYSLLVGRDDTS
NELVVGIIDYIRTFTWDKKLEMVVKSTGILGGQGKMPTVVSPELYRTRFCEAMDKYFLMV
PDHWTGLGLNC
NT seq 6336 nt   +upstreamnt  +downstreamnt
atggccacagatgataagacttccccaacattggactctgctaatgatttgcctcgatct
cctactagtccttctcatctcacacactttaaacctttgactcctgatcaggacgaacct
ccttttaaatcagcgtatagttcttttgtaaatctctttcgatttaacaaagagagagtg
gaagggggccagggagagcagccgtctctaagtggaagttggaccagccctcagctccct
tcaagaacacagtctgtgaggtcacctacaccttataaaaaacagcttaatgaggaactc
cagcggcgatcttcagcagtattagaagagaacagtttgcaacatccccaggagaataca
gacacaagaaggaaagcagagcctgcctttggaggtcatgaccctcgtacagctgttcag
cttcgaagcctcagcacagtattaaaacgcctcaaggaaatcatggaggggaaaagccag
gatagcgacctgaagcaatactggatgccagacagccaatgtaaagagtgctacgactgt
agtgagaaatttacaacctttaggcgcagacaccattgccgcttgtgtgggcagattttt
tgcagtcgttgctgtaatcaagaaatccctggaaaatttatgggctatacgggggacctc
cgagcttgcacatactgtagaaaaatagccttaagttatgctcattccacagacagtaat
tccattggggaagacttgaatgctctttcagattctgcttcctctgtgtctgtacttgat
ccaaatgaacctcgaacacctgttggaagtagaaaagccagccgcaacatatttttggag
gatgattttgcttggcaaagtttgattcatccagactcctcaaatactcctctttcaaca
aggcttgtatctgttcaagaagatgctgggaaatctcctgctcgaaatagatcagccagc
attactaacctgtcactggatcgatctggctctcccatggtgtcttcatatgagacatct
gtcagtccccaggctaaccggacatacgttaggacagagaccactgaggatgaacgcaaa
attcttctggacagtgttcagttaaaggacctgtggaagaaaatctgccatcacagtagt
ggaatggagtttcaggatcaccgttactggctgagaacgcatcccaactgcatcgtggga
aaagaattagtcaactggttgatccgaaatgggcacattgctacaagggcacaagctata
gcaatcggacaagccatggtcgatggacgttggctggactgtgtcagtcatcatgaccag
cttttcagggatgagtatgcgctgtacaggccattgcagagtacagaattttccgagacc
ccttctccagacagtgactccgtgaactctgtggaaggacactctgagccatcgtggttt
aaagacataaagtttgatgacagtgacacggaacagatagctgaagaaggtgacgataat
ttgactaattctgccagtcctagcaagcgcacatcagtcagcagtttccagtccacagtg
gacagtgactcagccgcgtccatcagcctgaacgtggagctggacaacgtgaacttccat
atcaagaagccctccaagtacccacatgtgccccctcaccctgctgaccaaaaagagtat
ttgatatctgacaatggaggacaacaactctcaataagtgacgccttcatcaaagaatcc
ttatttaatcgtcgagttgaggaaaaatccaaagagctgcctttcacacctttgggttgg
catcataacaacctggagctgctgagggaggagaatggagagaaacaagccatggagagg
ttgctctcagctaatcataaccacatgatggcactactccaacagttgctccataatgag
tcattgtcaccatcttggagggacatcattgtatcactggtctgccaggttgttcagaca
gtccgacctgatgtcaagaaccgggatgatgacatggacatccgtcagtttgtccatatt
aaaaaaattccaggtggaaagaagtttgattctgtggttgtcaatggatttgtttgtacc
aaaaatattgcacataaaaagatgaattcttgtattaaaaatcccaaaattcttctgttg
aaatgttccatcgagtatctctacagagaagaaactaaatttacctgcattgatcctatt
gtgcttcaggaaagggaattcttgaagaattatgttcagcgaatagttgatgttcgacct
acattggttctagttgaaaaaacagtgtctcggattgcccaagacatgttactagaacat
ggcattactttggtcattaatgtaaaatcacaagttttagaacgaatcagtcggatgacc
caaggtgatttagtaatgtcgatggaccagctgcttacaaaaccccacctgggcacctgt
cacaaattttatatgcagatctttcagttgcctaatgagcaaaccaaaacactgatgttt
tttgaaggctgtccacagcatctgggctgtacaatcaagcttagaggaggctctgattat
gagctggctcgagttaaagagatcctaatatttatgatctgtgtagcttatcattctcaa
ctagaaatctccttcctcatggatgaatttgctatgcctcctacgttaacacaaaaccct
tccttccattctctgattgaggggcgggaggatgaagggaccgcacaagagccgttcagc
ggaagtcccctcccccgggagcctgactttcctccagaatttctgccctccgatgatagc
agtttgctagaatcaaggattgtgtttgagaagggtgaccaggagaatagaagcattcca
caggatgttgcctgtttgaagcatcaagagtatgccacagcggcttgccccgcagggatc
ccctgtgctctctttccatcggtcccggaatcgttgttgccgctccacgtggacgaccag
caggatgctgtgggcttggagcagccggaggctttgcagcacccagatgagctacaggat
cccaaaagccagatgagagccttcagagaccctttgcaggatgacactggattgtatgtt
actgaggaggttacctcttctgaagataaacgaaagacttattctttggcttttaaacag
gaattgaaagacgtgatcctctgtatctccccagtaatcacattccgggagcccttcctt
ttaactgaaaaagggatgagatgctctacccgagattatttcgcagagcaggtttactgg
tctcctctcctcaataaagagttcaaagaagtggaaagcaggcggaagaagcagctgctt
agggatctctctggtcttcaaggcatgaacggaagtgttcaggccaaggctattcaagtc
ttgccctcgcacgagctagtgagcactagaattgctgagcatcttggggatagccagagc
ttgggtagaatgctggctgattatcgggccagaggaggaagaattcagcaaaaaaatgca
gacccttttgctcattcaaaggatgtacctggtacttcaagtggcagatcaggaagcaaa
actgatggtgacgaggagaaagggttgattccgagtgatgcagtgtggtcaacaaaggtg
gactgtctgaaccctgttaaccaccagagactgtgcgtgctcttcagcagctcttctgcc
cagtccagcaacgcccccagtgcctgtgtcagcccttggattgtaacaatggaattttat
ggaaagaatgatcttacattaggcatatttttagagagatactgtttcaggccttcttat
cagtgtcctagcatgttctgtgatacccccatggtgcatcatattcggcgctttgtccat
ggccaaggctgtgtgcagataattctgaaggagttagattctccagtacctggatatcaa
catacaattctcacctattcctggtgcagaatctgcaaacaggtaacaccagttgttgct
ctttccaacgagtcctggtccatgtcatttgcaaaataccttgaacttaggttttatggg
caccagtacactcgcagagccaatgctgagccgtgtggtcactccatccaccatgattat
caccagtatttctcctataatcagatggtggcatctttcagttattctcccattcggctt
cttgaagtatgtgttccactccctaagatattcattaaacgtcaggccccattaaaagtg
tcccttcttcaggatctaaaggacttctttcaaaaagtttcacaggtatatcttgctgtt
gatgaaagacttgcatctttgaaaaccgatacgtttagcaagacaagagaggaaaaaatg
gaagatatctttgcacaaaaagagatggaggaaggcgagttcaagaactgggtggagaag
atgcaagccaggctcatgtcctcctccgcggacgccccacagcagctgcagtctatcttc
gagtccctcattgccaagaagcagagtctgtgtgaagtgcttcaggcttggaataacaga
ttgcaggaccttttccagcaggaaaagggtagaaagcgaccttcagttcctccaagtcct
ggaagactgagacagggggaagaaagcaagataagtgcaatggatgcggctccacgaaat
atttctccaggacttcaaaatggagaaaaagaggaccgcttcctgaccaccctgtccagc
cagagccctgccagctcggcgcatctgcagctgcctacccccccggaagccctgcccgag
cagctggcgggagcgccccctgagcttgatacagccagcagttccgaagatgtgtttgat
ggacatttgctgggatccacagacagccaggtgaaggaaaaatcaaccatgaaagccatc
tttgcaaatttgcttccaggaaatagctataaccctattccatttccatttgatccagat
aaacactacttaatgtatgaacacgaacgggtacccattgctgtttgtgagaaggagccc
agctccatcattgcttttgctctcagttgtaaagaataccgaaatgccttagaggaatta
tccaaagcgactcagcggaacagtgccgaagaagggcttccaacaaatagtactttggac
agccgaccaaagagcagcagccctattagattacctgaggtcagcggaggacagacaaac
cgcacagcagaagcagaaccacagccaaccaaaaagacttctggaatgctgtccttcttc
cgagggacagcagggaaaagccctgatctctcttcccagaaaagagagaccttacgtgga
gcagacagtgcttactaccaggttgggcagacgggcaaggaggggacggagaatcaaggt
gctgagtctcaagatgaggtagatggaggagatacacaaaagaaacaactcataaatcct
cacgtggagctacaattttctgacgcgaatgccaagttttactgtcggctctactatgcg
ggagagtttcataagatgcgtgaggtgattctggggagcagtgaagaagatttcattcgt
tccctttcccactcgtcgccctggcaggcccgtgggggcaaatcaggagctgccttctat
gccacggaagatgatagattcattttgaagcagatgcctcgtctggaagtccagtctttc
cttgactttgcaccacactacttcaattatattacaaatgctgttcaacaaaagaggccc
actgcattggccaaaattcttggagtttacagaattggttataagaattctcagaacaat
actgagaagaagttagatctccttgtcatggaaaatcttttctatgggagaaagatggca
caggtttttgatttgaagggttcacttaggaatagaaatgtaaaaactgatactgggaaa
gagagctgtgatgtagtcctgctggatgaaaatctcttaaagatggttcgagacaacccc
ctgtatatccgttctcattccaaagccgtgctgagagcctcgatccgtagtgattcccac
ttcctttctagccacctcattatagattattctttgctggttggacgagatgataccagc
aatgagctggtagtcggaattatagattatattcgaacatttacatgggacaaaaagctt
gagatggttgtgaaatcaacaggaattttagggggacaaggtaaaatgcccaccgtggtt
tctccagagttgtacaggactagattttgtgaagcaatggacaagtacttcctgatggta
ccagaccactggacaggcttaggtctgaactgctga

DBGET integrated database retrieval system