KEGG   Felis catus (domestic cat): 101094393
Entry
101094393         CDS       T02385                                 
Symbol
CR2
Name
(RefSeq) complement receptor type 2 isoform X1
  KO
K04012  complement receptor type 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04610  Complement and coagulation cascades
fca04640  Hematopoietic cell lineage
fca04662  B cell receptor signaling pathway
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101094393 (CR2)
   04610 Complement and coagulation cascades
    101094393 (CR2)
   04662 B cell receptor signaling pathway
    101094393 (CR2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101094393 (CR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101094393 (CR2)
CD molecules [BR:fca04090]
 Proteins
  101094393 (CR2)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 101094393
NCBI-ProteinID: XP_006942880
Ensembl: ENSFCAG00000010589
UniProt: A0A5F5XQ34
LinkDB
Position
F1:complement(37293756..37328476)
AA seq 1474 aa
MGAAGLFCVVLALFAPGVLGQCKFLPRYHFAKPKIQSDQSEFAVGTSWEYECLPGYIKMS
FLITCLKTSKWSDPQRLCQRKSCGSPGELLHGSVLIPTGVLFGSTITYSCDKGYRLIGDS
SATCIISDNIVTWDKDMPFCESIPCAPPPAISNGDFYSSSRENFYYGMVVTYKCHVGQNG
KKLFDLVGEKSIYCTSKDNRVGIWSGPPPQCITLVKCPIPEVENGIIESGFGRSFYLNDT
VMFRCKPGFTMKGSNIVWCQANSKWNPPLPKCFKGCLPPPPINHGSYNILDKEFFPIGQE
VSYSCDPGYTLIGTNPIQCTSLGTWSHTAPECEAKSCDAIPNQLLNGRVVVPPNLKLGAE
VSFACDKGYRLNGQSSSQCVSEGTRVLWNNKFPVCERISCDPPPPIKNGWSSYSSGPIPL
NTVIRYTCSGNFRLIGERVIFCISKDQVKAIWDKGAPVCEYYNKNSFCSEPIVPGGYRDK
TSRPPYRHGDSVTFTCNTNFTMKGNKSVWCRANRTWGPTPLPICESDFPQECTSLPKIPN
GHHTGESVGSFAPGLSVTYSCEPGYLLVGEKTIRCLSSGKWSAAFPGCKEAQCEPPGPFL
NGEIEGPPSLRVGVTVNFYCNEGYWLQGQPSSRCVIAGQRASWTRMPVCKEILCGPPPSI
LNGRHTGNPSGNIPYGSMVTYACDPDPEKGVSFILTGKKTIHCTANSQKTGGVWSGPAPR
CELSSSAIQCPPPQIPRGHISSGWKEQYSYNDTVVFACTFGFTMKGSKVTRCNGQGAWEP
SVPVCEKECQAPPKILNGQKEDGHMVRFDPGTSIKYRCDPGYVLVGEKSIRCTSEGVWTP
TAPECKVAECEPIEKQVFKRPRDQFIRPDVNSSCDEGYRLGGSVYQLCQGAIPWFMEHRL
CEEITCPPPPVIYNGKHTRSSSENVPYGTTVTYTCNPGPESGVEFILVGESTIRCISNDQ
ERGIWSGPAPVCKLSLPAVQCPPAHVANGYKISGKEAPYFYNDSVTFKCNKGFTLKGSSQ
IRCKANNTWDPEIPVCEKGCPPPFGLQHGRHTGGNRVLFVSGMTVDYTCDPGYLLVGNKS
IHCMPSGNWSPSAPRCEEAPCQPVREDLREPPVHSHVVLVNTSCQEGYQLTGHAYQKCQD
AENRVWFQKIPLCKAVHCPPPPVIDHGRPRGVMAEHFLYGNEVSYECDQGFSLLGEKNIR
CISDSKGHGSWSGPTPQCFKSPPVTHCPNPEVKHGYKLNKTRSSYAHNDTVYVACNPGFI
MNGSNLIRCHTSNQWVPGVPTCIKMAFSGCQPPLDIPNGNHTGGDMARFSPGMSILYSCD
QGYLLVGEAFLLCTHEGTWSQPAPYCKEVNCSSPEYINGIQKGLEPGKMYQYGAIVTLEC
EEGYTLEGSPQSQCQDDHRWNPPLAVCKSPASLAPLLSGLSAGSVLLIFLIGVTLCTILK
HRERNYYTNKSPIEGDLHLETQEVYSIDPYNPAS
NT seq 4425 nt   +upstreamnt  +downstreamnt
atgggcgctgcgggcctgttctgcgtggtcttggcactcttcgcgccgggggtcctcggt
cagtgtaagttcctgccaaggtatcattttgctaagcctaaaattcagagtgatcagtct
gagtttgctgttgggacatcttgggaatatgaatgccttcctgggtatatcaagatgtca
ttccttatcacctgcctaaaaacctccaagtggtcagatcctcagcgattgtgtcaacgt
aaatcatgtgggagtcctggagaactcctccatggctctgtcctcatacccacgggtgtc
ctgtttgggtcaacaattacatattcttgtgataaaggatatcgactcattggtgattca
tctgctacatgtattatctcagacaatattgtaacctgggataaggacatgcctttttgt
gaatctattccttgtgcaccacccccagccatctccaatggggatttttacagcagcagt
agagagaacttttactatggaatggtggtgacttataagtgccacgttggacagaatgga
aaaaagttgtttgacctcgtgggtgagaagtccatatattgtaccagcaaagacaatcga
gttggcatctggagtggccctccccctcagtgtattactttagtcaagtgcccaattcca
gaagtcgaaaacggaattatagaatctggatttggacgttcattttatttaaatgatact
gtgatgtttaggtgtaagcctggctttaccatgaaaggcagcaacatagtatggtgccaa
gcaaacagcaaatggaatcctccgctgccaaagtgctttaaggggtgtctaccacctcca
cctatcaaccatggtagttataacatcttggataaggaattctttccaattggacaggaa
gtgtcctacagctgtgaccctggctacaccctcattggaactaaccctattcagtgtaca
tccttgggaacctggagccatacagcccctgaatgtgaagcaaaatcatgtgatgccatt
ccaaaccaacttctcaatggccgtgtggtggtcccccctaatctcaagcttggggcagag
gtttcgtttgcttgtgataaggggtaccgattaaatggccaatcttctagtcagtgtgtc
tcagaaggaacgagagtactctggaataataagtttcctgtctgtgaacgaatttcttgt
gaccctcctcctcctatcaaaaatggttggagtagttattcttctggtcccatacctctt
aacactgtgatacggtacacttgttctggtaacttccgcctcattggagaaagagtcatt
ttttgtataagtaaagaccaagtgaaggccatctgggataaaggtgctcctgtatgtgaa
tattataataaaaattctttttgctccgagcccatagtaccagggggatacagagataaa
acgtctagaccaccatacagacatggtgattccgtgacatttacctgtaataccaacttc
accatgaaaggcaacaaatctgtttggtgccgggcaaatagaacctgggggccaacacca
ctacccatctgtgagagcgatttcccgcaggagtgtacatcgcttcctaagatccccaat
ggacatcacacaggggagagtgttggctcctttgccccaggattgtctgtgacttacagc
tgtgaacctggttacttgcttgttggagaaaagaccattaggtgtctgtcttcaggaaag
tggagcgctgcttttcccgggtgtaaagaggcacagtgtgaacctccaggaccgtttctc
aatggagagatagagggccctccaagtcttcgggttggtgtaactgtgaacttttactgt
aatgaagggtattggttacaaggccaaccttctagtcggtgtgtaattgctggacagcgt
gcttcttggaccaggatgccagtgtgcaaagaaattctttgtgggccacctccttctatt
ctcaatggaaggcatacaggcaacccttcagggaacatcccatatggaagcatggtcact
tatgcttgtgacccagacccagagaaaggagtgagcttcatccttactgggaagaaaacc
atccattgtaccgccaatagtcagaagactggaggagtctggagtggccctgccccacgc
tgtgaactttctagctctgccattcagtgtccacctccccagatcccaagaggccacata
tcatctggatggaaagagcaatattcctataatgacaccgtggtatttgcttgcacattt
ggcttcaccatgaagggcagcaaggtgacccgatgtaatggccaaggtgcatgggagcca
tcggtaccggtctgtgaaaaggagtgccaagcccctcctaaaatcctcaatgggcaaaag
gaagatggacacatggtccgctttgacccaggaacatccataaagtaccgctgtgaccct
ggctatgtgctagtgggagaaaaatccatacgttgtacctctgagggggtgtggacaccc
accgcccccgaatgcaaagtggcagagtgtgaacctatagaaaaacaagtctttaagaga
ccccgggatcaatttattagaccagatgttaactcttcttgtgatgaagggtaccggtta
ggtgggagtgtttatcagttgtgtcaaggtgcgattccttggtttatggagcatcgtctt
tgtgaagaaatcacctgcccgccccctcctgtgatctacaatgggaaacacaccaggagt
tcctccgaaaatgttccatatggcaccacggtcacctacacatgcaaccctgggccagag
agcggagtggaattcatcctcgttggagagagcaccatccgttgtataagcaatgaccaa
gagaggggcatctggagtggccctgcccctgtctgtaaactctccctccctgctgttcag
tgtccacctgcccacgtggcaaacggatacaagatatctggcaaggaagccccatatttc
tacaatgacagtgtgacattcaagtgtaataagggatttactttgaagggcagcagtcag
attcgctgcaaagccaataacacctgggatcctgaaataccagtctgtgaaaaaggctgc
ccgccaccttttgggctccagcatggtcggcatacaggtggaaatagggtcctttttgtc
tctgggatgactgtagactacacctgtgaccctggctacttgctggtgggaaacaaatcc
attcactgtatgccttcgggaaattggagtccttctgcccctcggtgtgaagaagcaccg
tgtcaacctgtgagagaagatcttcgagagcctcctgttcactcacacgtggtactggtt
aatacgtcctgtcaagaggggtaccaactgactggacatgcttatcagaagtgtcaagat
gctgagaatagggtttggttccaaaagattccactttgtaaagctgttcactgcccgcct
ccaccagtgattgaccacgggaggcccaggggtgtgatggcagaacacttcctatatgga
aatgaagtctcttatgaatgtgaccagggattctcccttctgggagagaaaaatatacga
tgcatcagtgattctaaaggacatggatcttggagtggacctaccccccagtgcttcaaa
tctcctcccgtgacccactgccctaacccagaagtcaaacacggatataagctaaacaaa
actcgttcttcatatgcccacaatgacacagtatatgtcgcctgcaatcccggcttcatc
atgaatggcagtaacttgattaggtgtcataccagcaaccagtgggtgccaggtgtacca
acttgtatcaaaatggctttctcaggatgtcagcctccactagatatacccaatgggaat
cacactggtggagatatggctcgattttctcctgggatgtcaatcctgtacagctgtgac
caaggctacctgctggtgggagaggcattcctcctttgcacacatgagggaacctggagc
caacctgccccttattgtaaagaggtgaactgtagctccccagagtatattaacggaatc
cagaaggggctggagcctgggaaaatgtatcagtatggagctattgtcactttggagtgt
gaggaggggtataccctggaaggcagtccccagagccagtgccaggatgatcaccggtgg
aacccgcccctggctgtttgcaaatcgccagcctcacttgctcctcttctttctggtctt
tctgcaggctcagtacttcttatattcttgattggtgtcaccttatgcacgatattaaaa
cacagagaacggaattattatacaaacaaaagccctatagaaggagatcttcatttagaa
acacaagaagtctattctattgatccatacaacccggcaagctaa

DBGET integrated database retrieval system