KEGG   Felis catus (domestic cat): 101094520
Entry
101094520         CDS       T02385                                 
Symbol
HSPG2
Name
(RefSeq) basement membrane-specific heparan sulfate proteoglycan core protein
  KO
K06255  basement membrane-specific heparan sulfate proteoglycan core protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04512  ECM-receptor interaction
fca05161  Hepatitis B
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101094520 (HSPG2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101094520 (HSPG2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101094520 (HSPG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101094520 (HSPG2)
   00535 Proteoglycans [BR:fca00535]
    101094520 (HSPG2)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101094520 (HSPG2)
Proteoglycans [BR:fca00535]
 Extracellular matrix (ECM) proteoglycans
  Basement membrane proteoglycans
   101094520 (HSPG2)
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 ig Laminin_B V-set Laminin_G_1 Laminin_G_2 Laminin_EGF Ldl_recept_a C2-set_2 Ig_6 Laminin_G_3 EGF hEGF
Other DBs
NCBI-GeneID: 101094520
NCBI-ProteinID: XP_023114045
Ensembl: ENSFCAG00000002965
LinkDB
Position
C1:complement(16070729..16170453)
AA seq 4404 aa
MGQQAAGALLLALLLHGRLLAVTHGLRAYDGLSLPEDAETVTVGRDGRSYSDISDDEDLL
ADDASGDGLGSGEPGSGDFQMVYFRALVNFTRSIRYSPQLEDAGSEEFREVSEAVVDTLE
SEYLKIPGDQVVSVVFIKELDGWVFVELDVGSEGNADGAQIQEVLHTVISSGSVASYITS
PQGFQFRRLGTVPQFSRVCTEAEFACHSHNECVALEYRCDRRPDCRDMSDELNCEEEVPA
VSSVSPTLVETPPAVPWLEATTIQQLPGTPAPQPLLPGIARPVPCGPHEAMCHDGQCIPK
DYICDGQEDCKNGSDELNCGPPPPCEPNEFACGNGHCALKLWHCDGDFDCEDRTDEANCP
AKRPEDVCGPTQFRCVSTNTCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQESIQASR
GQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGRGTLTIRDVKEADQGAYTCE
AMNARGMVFGIPDGVLELIPKRGPCPDGHFYLEPSASCLPCFCFGVTSICQSSRRFRDQI
RLRFDQPNDFKGVNVTMPAQPGMPPLSSTQLQIDPAVQEFQLVDLSRRFLVHDSFWALPE
QFLGNKVDSYGGSLRYKVRYELARGMLEPVQRPDVVLVGAGYRLLSRGHVPTQPGTLNQR
QVQFSEEHWVHESGRPVQRAEMLQVLQSLEAVLIQTVYNAKMASVGLSDIAMDTTVSHAT
SHGRAHSVEECRCPIGYSGLSCESCDAHFTRVPGGPYLGTCSGCNCNGHASSCDPVYGHC
LNCQHNTEGPQCDKCKAGFFGDATKATATACRPCPCPYIDASRRFSDTCFLDTDGQATCD
ACAPGYTGRRCESCAPGYEGNPIQPGGKCRPTNQEIVRCDERGSMGSSGEACRCKNNVVG
RLCNECVAGSFHLSARNPDGCLKCFCMGVSRQCTSSSWSRAQVRGASEEPTQFSLTNAAG
THTTSEGISSPTSGELVFSSFHNLLSGPYFWSLPSRFRGDKVTSYGGELRFTVTQRPQPG
STPLHGQPMVVLQGNGIVLEHHTSQQPSPGQPSTFTVPFREQAWQRPDGQPATREHLLMA
LAGIDTLLIQASFSQRPAESRVSGISMDVAVPEDTGQDPALEVEQCTCPPGYRGPSCQDC
DTGYTRMPSGLYLGTCERCSCHGHSEICEPETGACQGCQHHTEGPQCERCQPGYYGDAQR
GTPQDCQPCPCYGAPAGGQATHTCFLDTDGHPTCDACSPGHSGRHCERCAPGYYGNPSQG
QPCQRDGQLPEPIGCGCDPKGSIGSQCDAAGQCYCKAQVEGLTCSHCRPHHFYLSASNPD
GCVPCFCMGVTQQCASSSYSRHLISTRFAPGDFQGFALVNPQRNSRLTGGFTVEPVPEGA
QLSFGTFAQLGHESFYWQLPEAYQGDKVAAYGGKLRYTLSYTAGAHGSPLSDPDVQITGN
NIMLVASQPAPQGPERKSFEIIFREEFWRRPDGQPATREHLLMALADLDELLVRATFSSM
PRAASISSVSLEVAQPGPSEGPRAMEVEECRCPPGYVGLSCQDCAPGYTRTGSGLYLGHC
ELCECNGHSDLCHPETGACSHCQHNTAGEFCELCAPGYYGDATAGTPEDCQPCACPLTNP
ENMFSRTCESLGAGGYRCTACEPGYTGQYCEQCAPGYVGNPNVRGGRCLPQADAAPLVVQ
VHPARTIVPQGGSHSLWCQVSGSPPHYFYWSREDGRPLPSSTQQRHQGSELHFPSVQPSD
AGVYICTCRNLHRANTSRAELLVTEAPSKPITVTVEEQRSQSVRPGADVTFICTAKSKSP
AYTLVWTRLHNGKLPARAMDFNGILTIRNVQLSDAGTYVCTGSNMFAMDQGTATLHVQAS
GTPSAPVVSIHPPQLTVQPGQLAEFRCSATGNPAPTLEWTGEAGVPGGQLPQKAQIHGGI
LRLPAVEPSDQAQYLCRALNSAGQHVARAVLHVHGGSGPRVQVSPERTQVHEGRTVRLYC
RAAGVPSATITWRKEGGSLPPQARSERTDIATLLIPAITAADAGFYLCVASSPAGTAQAR
IQVVVLPGASSPPVRIESSSPSVTEGQTLDLNCVVAGLAHTSITWYKRGGSLPPHSQVHG
SRLRLPQVSPADSGEYVCRVENESGPKEASIVVSVFHNTHPGPGYTPAPGGAPAPGSTQL
IRIESSSSHVAEGQTLDLNCVVPGQAHAQVTWHRRGGSLPARHQTHGSLLRLHQVSPADS
GEYICRVVLGSGPLEASVLVDIKASGSPPGSIPAPGPVPPVRIESTSPTVAEGQTLDLSC
VVAGQAHAQVTWYKRGGSLPARHQVRGSRLYIFQASPADAGEYVCRASNGMEASITVTVT
RTQGANFAYPPGSTQPIRIESSSSHVAEGQTLDLNCIVPGQAHAQVTWHKRGGSLPARHQ
THGSLLRLHQVSPVDSGEYVCRVVGGSVPLEASVLVTIEPAGSVPALGVTPPVRIESSSS
HVAEGQTLDLNCLVAGQAHAQITWHKRGGSLPARHQVHGSRLRLPQVTPADSGEYICRVV
SSSGTQEASVLVTIQQRLGPSHPQGVVYPVRIESSSASLANGHVLDLNCLVASQAPHTIT
WYKRGGSLPSRHQIVGSRLRIPQVTPADSGEYVCHVSNGAGSQETSLIVTIEGSGSSHVP
SVSPPIKIESSSPTVVEGQTLDLNCVVAGQPQATITWYKRGGSLPAQHQAHGSRLRLHHM
SVADSGEYVCRANNNIDAQEASIVVSVSPSTGSPSVPGGTMPVRIESSSSHVAEGQTVDL
NCVVPGQAHAQVTWHKRGGSLPTHHQAHGSRLRLYQVSPADSGEYVCQVVSSSGPLEASV
LVNIEASGSSAVPVPAPGGAPPIRIETSSSHVAEGQTLDLNCIVPGQAHAQVTWHRRGGS
LPARHQVHGPLLRLNQVSPADSGEYYCQVTSSSGTLEASVLVTIEASSPSPIPAPGLAQP
IYIEASSSHVAEGQTLDLNCVVPGQAHAQVTWHRRGGSLPARHQTHGSRLRLHHVSPADS
GEYVCRVVGGSGPEQEASFTVTVPPSAGSSYRLRSPVISIDPPSSTVQQGQDASFKCLIH
DGAAPISLEWKTRNQELEDNVHISPNGSIITIVGTRPSNHGAYRCVASNAYGVAQSVVNL
SVHGPPTVSVLPEGPVRVKVGKSITLECVSAGEPRSSAHWTRIGTPTNLEQRMYGVVDSH
TVLQISSAKPSDAGTYVCLARNALGTAQKRVEVIVDTGTVAPGAPQVQVEEAELTVEAGH
TATLRCSATGSPTPTIHWSKLRSPLPWQHRLEGDTLIIPRVAQQDSGQYICNATSPTGHA
EATIALHVESPPYATTVPEHASVRAGETVQIQCLAHGTPPLTFQWSRVGGNLPGRATARN
EMLRFEPAAPEDSGRYRCRVTNKVGSAEAFTQVLVQGPSGSVPATAIPAGSAPTVQVTPQ
LETKSVGASVEFHCAVPSDQGTQLRWVKEGGQLPPGHSVQDGVLRIQNLDQSCQGTYVCQ
AYGPWGQAQASAQLVVQALPSVLINIRTSVQTVVVGHAVEFECLALGDPKPQVTWSKVGG
RLRPGIVQSGGIVRIAHVELADAGQYRCTATNAAGTTQSHVLLLVQALPQISTPPEVRVP
AGSAAAFPCMVSGYPTPKITWSKLDGNLPPDSRVENTMLLLPSVRPQDAGTYVCTATNHQ
GKVKAFAHLQVPERVVPYFTQTPHSFLPLPTIKDAYRKFEIKITFRPDSADGMLLYNGQK
RIPGSPTNLASRQPDFISFGLVGGRPEFRFDAGSGMATIRHPTPLALGQFHTVTLLRSLT
QGSLIVGGLAPVNGTSQGKFQGLDLNEELYLGGYPDYGAIPKAGLSGGFVGCVRELRIQG
EEIIFHDLNLTAHGISHCPTCRDRPCQNGGQCQDSESSSYVCICPAGFTGSRCEHSQALH
CHPEACGPDATCVNRPDGRGYTCRCHLGRSGMRCEEGVTVTTPSMSGTGSYLALPALTNT
HHELRLDIEFKPLAPDGILLFSGGTSGPVEDFVSLAMVGGHLEFRYELGSGLAVLRTPEP
LALGHWHRVSAERLNKDGSLRVNSRRPVLRSSPGKSQGLNLHTLLYLGGVEPSVRLPPAT
NVSAHFRGCVGEVSVNGKRLDLTYSFLGSRGIGQCYTSSPCERQPCQNRATCMPTGEYEF
QCLCPDGFKGDLCEHEENPCRLREPCLHGGVCQGTRCLCPPGFSGPRCQQGSGQGTAESD
WHLEGSGGNDAPGQYGAYFHDDGFLALPGRVFSRSLPEVPETIELEVRTSTANGLLLWQG
VDVGEAGRGKDFISLGLQDGHLVFSYQLGSGEARLVSEDPINDGEWHRVTALREGRRGSI
QVDGEELVSGQSPGPNVAVNTKGSIYIGGAPDVSTLTGGRFSTGITGCIKNLVLHSARPG
APPPQPLDLEHRAQAGASTRPCPS
NT seq 13215 nt   +upstreamnt  +downstreamnt
atgggacagcaggcggcgggcgcgctgttgctggcgctgctgctgcacgggcggctgctc
gcggtgactcatgggctgcgggcgtatgatggcttatctctgcccgaggatgcagagaca
gtcacggtgggccgggacggcaggagctactcagacatctctgatgacgaagacttgctg
gctgacgatgcctctggagatggcctgggtagtggggagccaggcagcggggactttcag
atggtttatttccgggccctggtaaacttcactcgctccatccgctacagccctcagctg
gaggatgcgggctccgaggagttccgggaagtgtccgaggctgtggtcgacacgcttgag
tcggagtacttgaagattcccggagaccaggttgtcagtgtggtgttcatcaaggagctg
gacggctgggtcttcgtggagctggacgtgggctccgaagggaatgcagacggggctcag
attcaggaagtgcttcataccgtcatttccagcggctctgttgcctcctacatcacctct
ccccagggattccagttccggcgcctgggcacagtgccccagttctcaagagtctgcacc
gaggccgagttcgcctgccacagccacaacgagtgtgtggctctggagtatcgctgtgac
cggaggcccgactgcagggacatgtctgacgagctcaattgcgaggaggaggtcccggcg
gtcagctccgtgtcccccactctggtggagaccccaccggcggtgccctggctggaggca
accaccattcagcagctgccgggcacccccgctccgcagcctctgctccccgggatagcc
aggcctgtgccctgcgggccccacgaggccatgtgccacgacgggcagtgcatccccaag
gactacatctgcgacgggcaggaggactgcaagaacggcagtgatgagctgaactgcggt
ccccccccgccatgcgagcccaatgagttcgcctgtgggaacgggcactgcgccctgaag
ctgtggcactgtgacggcgactttgactgtgaggaccgcaccgatgaggccaactgccct
gccaagcgccccgaggatgtgtgcgggcccacgcagttccgctgtgtctccacaaacacg
tgcatcccagccagcttccactgtgatgaggagagtgactgtcccgaccgcagtgatgaa
tttggctgcatgcccccacaggtggtgacccctccccaggagtccatccaggcttcccgg
ggccagacagtgaccttcacctgtgtggccattggcgtccccacccccatcatcaactgg
aggcttaactggggccacatcccctctcatcccagggtgacagtgaccagcgaaggaggc
cgtggcacactgaccatccgtgatgtgaaggaggcagaccagggcgcctatacctgtgag
gccatgaatgcccggggcatggtgttcggcattcccgacggggtcctggagctcattcca
aagcgagggccctgccccgacgggcacttctacctggagcccagcgcctcctgcctgccc
tgcttctgctttggggtcaccagcatttgccagagcagccgccgcttccgagaccagatc
cggctccgctttgaccagcccaatgacttcaagggcgtgaacgtaacaatgcccgcacag
cccggcatgccgcccctctcctccacccagctgcagatcgaccccgctgtgcaggagttc
cagctggtcgacctgtcccgacgcttcctggtgcatgactctttctgggctctgcccgag
cagttcctgggcaacaaggtggactcctacggtggctccctgcgctacaaggtgcgctat
gagctggcccgaggcatgctggagccagtgcagcggccagacgtggtcctcgtgggagcc
ggatatcgcctcctctcccgagggcacgtgcccacccagcctggcacgctgaaccagcgc
caggttcagttctcggaggagcactgggtccatgagtctggccggccagtgcagcgggcc
gagatgttgcaggtgctgcagagcctggaggctgtgctcatccaaacagtgtacaacgcc
aagatggccagcgtgggactgagtgacattgccatggataccaccgtcagccacgccacc
agccacggccgggcccacagcgtggaggagtgcagatgccccattggctactctggctta
tcctgcgagagctgtgatgcccatttcacccgggtgcctggtgggccctacctgggcacc
tgctctggctgcaactgcaatgggcatgccagctcttgtgaccctgtgtatggccactgc
ctgaattgccagcacaacacagaggggccacagtgcgacaagtgcaaggctggtttcttc
ggggacgccacaaaggccacagccactgcctgccgaccctgcccttgcccatacattgac
gcctcccgcaggttctcagacacctgcttcctggacacggatggccaagccacatgtgat
gcatgtgccccaggctacacgggccgccgctgtgagagctgtgcccctggatacgagggc
aaccccatccagccaggcgggaagtgcaggcccaccaaccaggagatcgtgcgctgtgac
gagcgaggcagcatggggagctctggggaggcctgccgctgtaagaacaacgtggtgggg
cgtctgtgcaatgagtgtgtcgccggctctttccacctgagtgcccgcaaccctgacggc
tgcctcaagtgcttctgcatgggcgtcagtcgccagtgcaccagctcctcctggagccgc
gcccaggtgcgtggggcttccgaggagcccactcagttcagcctgaccaacgccgcaggc
acccacaccaccagcgagggcatctcatcacccacatccggagaactggtcttctcctcc
ttccacaacctcctctccggaccctacttctggagcctcccctcgcgctttcgcggggac
aaggtgacctcctatgggggagagctgcgcttcacggtgacccagcggccccagcctggc
tccacacctctgcacgggcagccgatggttgtattgcagggcaatggcatcgtcttagag
catcacacttcccagcagcccagccccggccagcccagcaccttcacggtgcccttccgg
gagcaagcgtggcaacggcctgatgggcagccggccacccgggaacacctgctgatggcc
ctggcgggcatcgacaccctcctgatccaggcgtccttcagccagcggccagctgagagc
agggtctctggtatcagcatggacgtggctgtgcctgaggacaccggccaggaccccgcg
ctggaagtagaacagtgtacctgcccacccgggtaccgcggcccatcctgccaggactgt
gacacgggctacacacgcatgcccagcggactctacctgggcacctgtgaacgttgcagc
tgccacggccactcggagatctgtgagcccgaaacaggtgcctgccagggctgccaacac
cacacggagggccctcagtgcgagcggtgccaaccaggatactatggggacgcccagcgg
gggacgccacaggactgccagccgtgcccatgctatggagcccccgctggtggccaggct
acccatacttgctttctggacacggacggccaccccacctgtgatgcgtgctccccaggc
cacagcgggcgtcactgtgagaggtgtgccccaggttactatggcaaccccagccagggc
cagccgtgccaaagagacggccaactgccagagccgatcggctgtggctgtgaccccaag
ggcagcatcggtagccagtgtgacgctgctggccagtgctattgcaaggcccaggtggaa
ggcctcacctgcagtcactgccggccccaccacttctacctgagcgccagcaaccccgac
ggctgcgtgccttgcttctgcatgggtgtcacccagcagtgtgccagctcctcctacagc
cgccacctgatctccacccgctttgcccctggggacttccaaggctttgccctggtgaac
ccgcaacggaacagccgcctgacaggaggcttcaccgtggagcccgtgcctgagggtgcc
cagctctctttcggcaccttcgcccagcttggccatgagtccttctactggcagcttccg
gaggcgtaccagggagacaaggtggcggcctatggcgggaagctgcgatataccctctcc
tacacggcgggggcgcatggcagtccgctctctgaccctgacgtccagatcacgggcaac
aacatcatgctggtggcctcccagccagcgccgcagggcccagagaggaagagcttcgag
atcattttccgagaggaattctggcgccggcctgatgggcagccggccacgcgcgagcac
ctcctgatggcgctggccgacctggatgagctcctggtccgggccacgttctcctcgatg
ccacgggcagccagcatcagctccgtcagcctggaggtcgcccagcctgggccctcagag
ggaccccgggccatggaggtggaggaatgccgctgtcccccgggctatgttggcttgtca
tgccaggactgtgccccaggctatacacgcactggcagcggactctacctcggccactgt
gagctgtgtgaatgcaacggccactcagacctgtgccacccggagaccggggcctgctcg
cactgccagcacaacaccgctggggaattctgtgagctgtgtgcccctggctattatgga
gatgctactgccgggacacctgaggactgccagccctgcgcctgcccactgaccaacccg
gagaacatgttctcccgcacctgtgagagcctgggagctggcgggtaccgatgcacagcc
tgtgaacctggctacactggccagtactgtgagcaatgtgccccaggctacgtgggtaac
cccaatgtgcgggggggccggtgcctgccccaagcagatgcagccccactggtggtccag
gtgcatccggctcggaccatagtaccccaaggtggctcccactccctgtggtgccaggtc
agtgggagcccaccccactacttttactggtctcgtgaggatgggcgtcccttgcctagc
agcacccagcagcgacatcaaggctctgagctccacttccctagcgtccagccatcagat
gctggcgtctatatctgcacctgtcgtaatctccatcgcgccaataccagccgggcagag
ctgctggtcaccgaggctccaagcaagcccatcacggtgaccgtggaggagcagcggagc
cagagcgtgcgccccggggctgatgtcaccttcatctgcacagccaagagcaagtctcct
gcttacaccctggtttggacccgcctgcacaatgggaaactgccagcccgagccatggat
ttcaacggcatcctgaccattcgcaacgtacagctgagcgacgcgggcacctacgtctgc
acgggctccaacatgttcgccatggaccagggcacggccacactgcacgtgcaagcctcg
ggcaccccgtccgccccggtggtctccatccatccgccgcagctcaccgtgcagcccgga
cagctggccgagttccgctgcagtgccaccgggaaccccgcgcccaccctcgagtggaca
ggtgaagccggggtccctggcggccagctccctcagaaggcacagatccacggcggcatc
ctgcgcctgccagccgtcgagccctcggatcaagcccagtacctgtgtcgtgcccttaac
agtgccgggcagcacgtggccagggccgtgctccacgtgcatgggggcagcgggcccagg
gtccaggtgagcccagagaggactcaggtacacgaaggtcgcaccgtcaggctgtactgc
agggccgcaggggtgcccagcgccaccatcacctggaggaaggaagggggcagcctcccc
ccacaggcccggtccgagcgcacagacatcgccacgctgctcatcccggccatcacggct
gccgacgccggcttctacctctgcgtggccagcagccccgcgggcaccgcgcaggcccgg
atccaagtggttgtccttccaggtgccagctccccgccagtcaggatcgagtcctcatcg
ccttcggtgactgaaggccagacgctggacctcaactgtgtggtggccggcctggcccac
acctccatcacgtggtacaagcgagggggcagcctgcctccccacagccaggtgcatggc
tcccggttacggcttccccaggtttctccagctgattctggagaatacgtctgccgagtg
gagaacgagtcaggccccaaggaggcctccatcgtcgtctctgtcttccacaacacccac
ccaggccctggctacaccccagctcctggaggagccccagctccgggcagcacccagctc
atccgcatcgagtcctcctcctctcacgtggctgaaggacagaccctggacctgaactgc
gtggtgcccgggcaggcccacgcgcaggtcacatggcacaggcgtgggggcagcctcccc
gcccggcaccagacccatggctcgctgctgcggctgcaccaggtgtctccagccgactcg
ggcgagtacatatgccgcgtggtccttggctctgggcccctggaggcctccgtcctggtc
gacatcaaggcctccggctcccctccgggctccatccctgccccaggacctgtcccccct
gtcaggatcgagtccacatcccccacagtggccgaggggcagaccctggatctgagctgt
gtggtggcagggcaggcccatgcccaggtcacgtggtacaagcgtgggggcagcctcccc
gcccggcaccaggtccgcggctcccgcctgtacatcttccaggcctcgccagccgacgca
ggcgagtacgtttgccgggccagcaatggtatggaggcctctatcacagtcaccgtaacc
aggacccagggggccaactttgcctaccctccgggcagcacccagcccatccgcatcgag
tcctcctcctcccacgtggctgaagggcagaccctggatctgaactgcatagtgcctggg
caggcccacgcccaggtcacgtggcataagcgtgggggcagcctccctgcccggcaccag
acccacggctcactgctgagactacaccaggtgtccccagttgactcgggcgagtatgtg
tgccgcgtggtgggtggctcggtgcccctggaggcctctgtcctggtgaccattgagcct
gcaggctctgtacctgcactgggggtcactcccccagtccggatcgagtcatcctcctcc
catgtggctgaagggcagaccttggatctgaactgcctggttgctgggcaggcccatgcc
cagatcacgtggcacaagcgagggggcagcctccccgctcggcaccaggtgcatggctcg
aggctgcggctgccccaggtgaccccagccgactctggggagtacatatgccgtgtggtc
agcagctcgggcacccaagaagcctcagtccttgtcactatccagcagcgccttggcccc
tcccacccccagggcgtggtataccccgtccgcatcgagtcctcctcagcctccctggcc
aatggacacgtcctggacctcaactgcctggtggccagccaagccccgcacaccatcacc
tggtataagcgtggaggtagcctacccagccggcaccagatcgtgggctcccgactgcgg
atcccccaggtgacacctgcagactctggcgagtacgtgtgtcacgtcagtaacggtgcc
gggtcccaggagacctcactcatcgttaccatcgagggcagcggctcctcccatgtgccc
agtgtctccccaccaatcaagatcgagtcctcgtcccccacggtggtcgaaggacagacc
ttggatctgaactgcgtagtcgccgggcagccccaggccaccatcacgtggtacaagcgt
gggggcagccttcctgcccaacaccaggcccatggctcccgcctacggctgcaccacatg
tctgtggctgactccggcgagtacgtgtgccgggccaacaacaacatcgatgcccaggag
gcctccatcgtggtctcagtgtcccccagcactggcagcccctctgtccctggcggtacg
atgcccgtcagaatcgagtcgtcttcctcccacgtggccgaagggcagaccgtggatctg
aactgcgtggtccctggccaggcccacgcccaggtcacgtggcacaagcgcgggggcagc
ctccccactcaccaccaggcccatggctcacggctgaggctgtaccaggtgtccccggct
gactcgggcgagtacgtgtgccaggtggtgagcagctcgggccccctggaggcctcagtc
ctggtcaacatcgaggcctctggctccagtgctgttcctgtccctgccccaggcggagcc
ccacccatccgcattgagacctcctcctcccatgtggccgaagggcagaccctggatctg
aactgcatagtccctggacaggcccacgcccaggtcacatggcacaggcgcgggggcagc
cttcctgcccggcaccaggtccacggacccctgctaaggctgaatcaggtgtccccggct
gactctggagaatactactgtcaagtgaccagcagctcaggcaccctggaggcttctgtt
ctagtcacgattgaggcctccagcccaagccccattcctgccccaggactggcccagccc
atctatatcgaggcctcctcctcccacgtggccgaaggacagaccctggacctgaactgc
gtggtgccggggcaggcccacgcgcaggtcacatggcacaggcgtgggggcagcctcccc
gcccggcaccagacccacggctcccggctgcggctccaccacgtgtcccctgctgactcc
ggcgagtacgtgtgccgcgtggttggcggctcaggccctgagcaggaggcttccttcaca
gtcactgtcccacccagtgcggggtcctcctaccgccttaggagccccgtcatctctatc
gacccgcccagcagcactgtgcagcagggccaagatgccagcttcaagtgcctcatccat
gacggggcagcccccatcagcctcgagtggaaaactcggaaccaagaactggaggacaat
gtccacatcagccccaatggctccatcatcaccatcgtgggcacccgacccagcaaccac
ggtgcttaccgctgcgtggcctccaacgcctacggcgtggcccaaagtgtcgtcaacctc
agtgtgcacgggccccctactgtgtctgtgctccctgagggtcccgtgcgggtgaaggta
ggaaagtccatcaccctggaatgtgtcagtgctggggagccccgctcttcggctcactgg
acccggattggcacccccaccaacctagaacagcggatgtatggggtcgtggatagccat
acggtgttgcagatttcatcagctaaaccatcggatgcaggcacctacgtatgcctggct
cggaatgcactaggcacagcacagaagcgggtggaggtgattgtggacacaggcactgtg
gccccaggggccccccaggttcaagttgaagaagccgagctgactgtagaggccggacac
acagccaccctgcgctgctcagccacaggcagccccacgcccaccatccactggtccaag
ctgcgctccccactgccctggcagcaccggctggaaggtgacacactgatcatcccccgg
gtggcccagcaggactcaggccagtacatctgcaacgccaccagccctaccgggcatgcc
gaggccaccatcgccctgcatgtggagagcccaccgtatgccaccacagtcccggagcac
gcttcggtgcgggcaggagagacggtgcagatccagtgcctggcgcatgggacacccccg
ctcaccttccagtggagccgtgtgggtggcaacctccctgggagggcgactgccaggaac
gagatgctgcgctttgagcccgcggcccccgaggactcaggccgctaccgttgccgggtc
accaacaaggtgggctcggctgaggccttcacccaggtgctcgttcaaggcccctctggc
tctgtcccggccaccgccatcccagcaggatccgcgcccaccgttcaggtcacacctcag
ctggagaccaagagcgtaggggccagcgtcgagttccactgtgccgtgcccagtgaccag
ggcacccagctccgttgggtcaaggaagggggtcagctgcctcctggccacagtgtgcag
gatggggtgctccgaatccagaacttggaccagagctgccaagggacatatgtttgccag
gcctatggaccatggggacaggcccaggccagtgcccagctggtcgtccaagccctgccc
tcggtgctcatcaacattcggacctccgtgcagaccgtggtggtcggccatgccgtggag
ttcgagtgcctggccctgggtgaccccaagccgcaggtgacatggagcaaagtcgggggg
cgcctgcggcctggcatcgtgcagagcgggggcatcgtcaggatcgcccacgtggagctg
gccgatgcggggcagtaccgctgcacggccaccaacgccgctggcaccacccagtcccac
gtgctgctgctcgtgcaagccttgccccagatctccacgcccccagaggtccgtgtgcct
gctggttctgcagccgccttcccctgcatggtctctggctaccccactcccaagatcacc
tggagcaagctggacggtaacctgccacctgacagccgcgtggagaacaccatgctgctg
ctgccctcggtccgacctcaggacgcaggcacttacgtctgcactgctaccaatcaccag
ggcaaggtcaaagcctttgcccatctgcaggtgccggagcgggtggtgccctacttcaca
cagaccccccactccttcctgccactgcccaccatcaaagatgcctacaggaagttcgag
atcaagatcaccttccgtcctgactcagccgatgggatgctgctgtataatgggcagaag
cggatcccagggagccccaccaacctggccagcaggcagcctgacttcatctccttcggc
ctcgtgggtggaaggcctgagttccggtttgacgcaggctcaggcatggccaccatccgc
caccccactccgctggcactgggccagttccacaccgtgaccctgctgcgcagccttacc
cagggctccctgattgtgggcggcctggccccggtcaacgggacctctcagggcaagttc
cagggcctggacctaaacgaggagctctacctgggtggctaccccgactacggcgccatc
cccaaggcggggctgagcggcggcttcgtaggctgtgtccgggagctgcgcatccagggc
gaggagatcatcttccacgacctcaaccttacggcgcacggcatctcccactgccccacc
tgtcgggaccggccctgccagaacgggggccaatgtcaggattcagagagcagcagctac
gtgtgcatctgcccggctggcttcaccgggagccgctgtgagcactcccaggccctgcac
tgccacccagaggcctgtgggcccgacgccacctgtgtgaaccggcctgacggtcgaggc
tacacctgtcgctgccatctgggccgctcagggatgagatgcgaggaaggtgtgacggtg
accaccccctccatgtcgggcactggctcctacctggcactgcccgccctcaccaacacg
caccatgaactgcgcctggacattgagttcaagccgctggcgcctgacggcatcctgctg
ttcagcggggggactagcgggcctgtggaggacttcgtgtccctggcgatggtcggcggc
cacctggagttccgatatgagctagggtcagggctggccgtgctgcggacccccgagccg
ctggccctgggccactggcaccgagtatccgcggaacgtctcaacaaggacggcagcctg
cgcgtgaacagcagacgccccgtgctgcgctcctcgcccggcaagagccagggcctcaac
ctgcacaccctcctctacctcggcggcgtggagccctccgtgcgtctgcccccggccacc
aacgttagcgctcacttccgtggctgtgtgggcgaggtgtcagtgaacgggaagcggcta
gacctcacctacagctttctgggcagccggggcatcgggcagtgctacaccagctccccg
tgtgagcgccagccttgccagaaccgtgccacgtgcatgcctaccggcgagtacgagttc
cagtgcctgtgtcccgatggcttcaaaggagacctctgtgagcacgaggagaacccctgc
cggctccgtgagccctgtctgcacgggggcgtctgccagggcacccgctgcctctgtccc
cccggcttctctggcccacgctgccaacaaggctctggacaaggcacagccgagtctgat
tggcatctggaaggcagcgggggtaacgatgcccctgggcagtacggagcctatttccac
gatgacggcttcctagctctccccggccgcgttttctccaggagcctgcccgaggtgcca
gagaccatcgagctggaggttcggacgagcacggccaatggcctcctgctctggcagggc
gtggatgtgggagaggccggccgcggcaaggacttcatcagtctcgggcttcaggacggg
caccttgtcttcagctaccagctgggcagcggggaggcccgcctcgtctccgaggacccc
atcaatgatggcgagtggcatcgggtgacggcactgcgagagggccgaagaggctccatc
caggtggacggcgaggagctggtcagtggccagtccccaggccctaacgtggccgtcaac
accaagggcagcatctacatcggtggagctcccgacgtgagcacgctgaccgggggcagg
ttctccacgggcatcaccggctgtatcaagaacctggtgctgcactctgcccggcctggc
gccccgcccccacagccgctggacctggagcaccgcgcccaggcgggggccagcacgcgc
ccctgcccctcgtag

DBGET integrated database retrieval system