KEGG   Felis catus (domestic cat): 101094625
Entry
101094625         CDS       T02385                                 
Symbol
CTSD
Name
(RefSeq) cathepsin D
  KO
K01379  cathepsin D [EC:3.4.23.5]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04071  Sphingolipid signaling pathway
fca04140  Autophagy - animal
fca04142  Lysosome
fca04210  Apoptosis
fca04915  Estrogen signaling pathway
fca05152  Tuberculosis
fca05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    101094625 (CTSD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101094625 (CTSD)
   04140 Autophagy - animal
    101094625 (CTSD)
  09143 Cell growth and death
   04210 Apoptosis
    101094625 (CTSD)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101094625 (CTSD)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101094625 (CTSD)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101094625 (CTSD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    101094625 (CTSD)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101094625 (CTSD)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.5  cathepsin D
     101094625 (CTSD)
Peptidases and inhibitors [BR:fca01002]
 Aspartic peptidases
  Family A1: pepsin family
   101094625 (CTSD)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101094625 (CTSD)
SSDB
Motif
Pfam: Asp TAXi_N A1_Propeptide TAXi_C
Other DBs
NCBI-GeneID: 101094625
NCBI-ProteinID: XP_011285369
Ensembl: ENSFCAG00000007823
UniProt: M3W8G3
LinkDB
Position
D1:116232478..116242569
AA seq 408 aa
MQPPSVLLLVLGLLAASAAALIRIPLHKFTSVRRTMSELGGPVEDLIAKGPISKYAQGVP
AVTGGPIPEILKNYLDAQYYGEIGIGTPPQCFTVVFDTGSANLWVPSIHCKLLDIACWLH
NKYNSGKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQTPTVAGVKVERQIFGEAIK
QPGITFIAAKFDGILGMAYPRISVDDVLPVFDNLMKQKLVEKNIFSFYLNRDPNAQPGGE
LMLGGTDSKYYKGPLSYLNVTRKAYWQVHMDQVDVGTSLTLCKGGCEAILDTGTSLMVGP
VDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPEVTVKLGGKGYKLSSKDYTLKVSQGGRT
ICLSGFMGMDIPPPGGPLWILGDVFIGRYYTVFDRDENRVGLAEATRL
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgcagccccccagcgtgctgctgctcgttctcggcctgctggccgcgtccgccgccgcg
ctcatcagaatcccgctgcacaagttcacatctgtgcgtcgaaccatgtcggagttgggg
ggccccgtggaagatctgattgccaagggccccatttcgaagtatgcccagggagtgccc
gctgtgactggggggcccattcccgagatactgaagaactacctggacgcccagtactac
ggggagatcggcattgggacgcccccacagtgcttcacggtcgtcttcgacaccggttcc
gccaacctgtgggtcccctcgatccactgcaagctgctggacatcgcctgctggctccac
aacaagtataacagcggcaagtccagcacgtacgtcaagaatggcacgtccttcgacatc
cactacggctccggcagcctctccgggtacctgagccaggacaccgtgtcggtaccctgc
cagactccgaccgtggctggcgtcaaggtggagaggcagatcttcggtgaggccatcaag
cagccgggcatcaccttcatcgcagccaagttcgacggcattctcggcatggcctacccc
cgtatctccgttgacgacgtgctccccgtctttgataacctgatgaagcagaagttggtg
gagaagaacatcttctccttctacctgaacagggaccctaacgcacagcccgggggtgag
ctgatgctgggtggcacggactccaagtactacaagggccccctgtcctacctgaacgtc
acccgcaaggcgtactggcaggtccacatggaccaggtggatgtgggcaccagcctgact
ctgtgcaaggggggctgtgaggccatcctggacacgggcacctccctcatggtgggcccc
gtggacgaggtgcgcgagctgcagaaggccattggggctgtgccgctgatccagggcgag
tacatgatcccctgtgagaaggtgtccaccctgcccgaggtcactgtgaagctggggggc
aaagggtacaagctgtcctcgaaggactacacgctcaaggtgtcgcagggcgggaggacc
atatgcctgagcggcttcatgggtatggacatccccccgcccggtgggccgctctggatc
ctgggtgacgtcttcatcggccgctactacaccgtgttcgaccgggacgagaaccgggtg
ggcctggccgaggccaccaggctgtag

DBGET integrated database retrieval system